PDB entry 3n7z

View 3n7z on RCSB PDB site
Description: crystal structure of acetyltransferase from bacillus anthracis
Deposited on 2010-05-27, released 2010-06-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase, GNAT family
    Species: Bacillus anthracis [TaxId:260799]
    Gene: BAS2743
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: acetyltransferase, GNAT family
    Species: Bacillus anthracis [TaxId:260799]
    Gene: BAS2743
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: acetyltransferase, GNAT family
    Species: Bacillus anthracis [TaxId:260799]
    Gene: BAS2743
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: acetyltransferase, GNAT family
    Species: Bacillus anthracis [TaxId:260799]
    Gene: BAS2743
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: acetyltransferase, GNAT family
    Species: Bacillus anthracis [TaxId:260799]
    Gene: BAS2743
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: acetyltransferase, GNAT family
    Species: Bacillus anthracis [TaxId:260799]
    Gene: BAS2743
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7zA (A:)
    snamnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaakl
    hlipfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfav
    sfyrkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgm
    lvrnekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnf
    icqhdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvq
    qevilhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnel
    elisgseeeirafesvvpvrkpfiydff
    

    Sequence, based on observed residues (ATOM records):
    >3n7zA (A:)
    mnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaaklhli
    pfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfy
    rkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvr
    nekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnficq
    hdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnqqevil
    hitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnelelisg
    seeeirafesvvpvrkpfiydff
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n7zB (B:)
    snamnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaakl
    hlipfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfav
    sfyrkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgm
    lvrnekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnf
    icqhdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvq
    qevilhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnel
    elisgseeeirafesvvpvrkpfiydff
    

    Sequence, based on observed residues (ATOM records):
    >3n7zB (B:)
    nvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaaklhlip
    fhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfyr
    kygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvrn
    ekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnficqh
    dsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvqqevi
    lhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnelelis
    gseeeirafesvvpvrkpfiydff
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n7zC (C:)
    snamnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaakl
    hlipfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfav
    sfyrkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgm
    lvrnekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnf
    icqhdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvq
    qevilhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnel
    elisgseeeirafesvvpvrkpfiydff
    

    Sequence, based on observed residues (ATOM records):
    >3n7zC (C:)
    nvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaaklhlip
    fhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfyr
    kygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvrn
    ekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnficqh
    dsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnqevilhi
    tdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnelelisgse
    eeirafesvvpvrkpfiydff
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n7zD (D:)
    snamnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaakl
    hlipfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfav
    sfyrkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgm
    lvrnekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnf
    icqhdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvq
    qevilhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnel
    elisgseeeirafesvvpvrkpfiydff
    

    Sequence, based on observed residues (ATOM records):
    >3n7zD (D:)
    nvirlkedkfrealrlseyafqykvedrlqqqitkmkeshevygimegenlaaklhlipf
    hiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfyrk
    ygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvrne
    kwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnficqhd
    smikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvqqevil
    hitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnelelisg
    seeeirafesvvpvrkpfiydff
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n7zE (E:)
    snamnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaakl
    hlipfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfav
    sfyrkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgm
    lvrnekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnf
    icqhdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvq
    qevilhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnel
    elisgseeeirafesvvpvrkpfiydff
    

    Sequence, based on observed residues (ATOM records):
    >3n7zE (E:)
    nvirlkedkfrealrlseyafqykvedrlqqqitkmkeshevygimegenlaaklhlipf
    hiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfyrk
    ygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvrne
    kwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnficqhd
    smikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwqevilhitd
    sfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnelelisgseee
    irafesvvpvrkpfiydff
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n7zF (F:)
    snamnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaakl
    hlipfhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfav
    sfyrkygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgm
    lvrnekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnf
    icqhdsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnvq
    qevilhitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnel
    elisgseeeirafesvvpvrkpfiydff
    

    Sequence, based on observed residues (ATOM records):
    >3n7zF (F:)
    nvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaaklhlip
    fhiyigkekfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfyr
    kygwelcanllvchmtksdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvrn
    ekwwlqavyddltlaiyydenqtaagymlykienykmtveefvplhnearnglwnficqh
    dsmikdlemtvsenepllytlqeprvkteikpyfmgrivdveqflkqyelnwnnqqevil
    hitdsfaqwnnitvrianheitiieepidkgikldinalstilfgyrrplelnelelisg
    seeeirafesvvpvrkpfiydff