PDB entry 3n7y

View 3n7y on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a 20-Membered Macrocyclic Ligand Having the Sequence pYVNV
Class: protein binding/peptide
Keywords: ligand preorganization, macrocycles, macrocyclic ligands, Golgi apparatus, Host-virus interaction, Phosphoprotein, protein binding-peptide complex
Deposited on 2010-05-27, released 2011-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n7ya_
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n7yb_
  • Chain 'C':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n7yc_
  • Chain 'D':
    Compound: 20-membered peptide-like macrocyclic ligand
    Database cross-references and differences (RAF-indexed):
    • PDB 3N7Y (0-4)
  • Chain 'E':
    Compound: 20-membered peptide-like macrocyclic ligand
    Database cross-references and differences (RAF-indexed):
    • PDB 3N7Y (0-4)
  • Chain 'F':
    Compound: 20-membered peptide-like macrocyclic ligand
    Database cross-references and differences (RAF-indexed):
    • PDB 3N7Y (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n7yA (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n7yB (B:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n7yC (C:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.