PDB entry 3n7x

View 3n7x on RCSB PDB site
Description: crystal structure of penaeus stylirostris densovirus capsid
Deposited on 2010-05-27, released 2010-11-17
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Infectious hypodermal and hematopoietic necrosis virus [TaxId:111792]
    Gene: capsid protein
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7xA (A:)
    mcadstrtsprkrsrrdahnedeehaegssgpdphrclqfntgdsihitfqtrryfefda
    andgnfdgknlyclplhwmnlylyglkssdssatetqrykmvksmmktygwkvhkagvvm
    hsmvplmkdlkvsggtsfetltftdtpyleifkdttglhnqlstketdvtlakwiqnpql
    vtvqstaanyedpiqqfgfmeqmrtgdrkaytihgdtrnwyggeipttgptfipkwggqi
    kwdkpslgnlvypadhhtndwqqifmrmspikgpngdelklgcrvqadfflhlevrlppq
    gcvaslgmlqylhapctgqlnkcyimhtn
    

    Sequence, based on observed residues (ATOM records):
    >3n7xA (A:)
    gpdphrclqfntgdsihitfqtrryfefdaandgnfdgknlyclplhwmnlylyglkssd
    ssatetqrykmvksmmktygwkvhkagvvmhsmvplmkdlkvsggtsfetltftdtpyle
    ifkdttglhnqlstketdvtlakwiqnpqlvtvqstaanyedpiqqfgfmeqmrtgdrka
    ytihgdtrnwyggeipttgptfipkwggqikwdkpslgnlvypadhhtndwqqifmrmsp
    ikgpngdelklgcrvqadfflhlevrlppqgcvaslgmlqylhapctgqlnkcyimhtn