PDB entry 3n7u

View 3n7u on RCSB PDB site
Description: NAD-dependent formate dehydrogenase from higher-plant Arabidopsis thaliana in complex with NAD and azide
Deposited on 2010-05-27, released 2010-06-09
The last revision was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: formate dehydrogenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g14780, FDH, FDH1, T9L3_80
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, AZI, SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uA (A:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uB (B:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uC (C:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uD (D:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uE (E:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uF (F:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uG (G:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uH (H:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uI (I:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uJ (J:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uK (K:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >3n7uL (L:)
    dskkivgvfykaneyatknpnflgcvenalgirdwlesqghqyivtddkegpdcelekhi
    pdlhvlistpfhpayvtaerikkaknlkllltagigsdhidlqaaaaagltvaevtgsnv
    vsvaedelmrililmrnfvpgynqvvkgewnvagiayraydlegktigtvgagrigklll
    qrlkpfgcnllyhdrlqmapeleketgakfvedlnemlpkcdvivinmpltektrgmfnk
    eligklkkgvlivnnargaimerqavvdavesghiggysgdvwdpqpapkdhpwrympnq
    amtphtsgttidaqlryaagtkdmleryfkgedfptenyivkdgelapqyr