PDB entry 3n7t

View 3n7t on RCSB PDB site
Description: Crystal structure of a macrophage binding protein from Coccidioides immitis
Class: protein binding
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, macrophage, pathogenic fungus, coccidioidomycosis, Valley Fever, meningitis, PROTEIN BINDING
Deposited on 2010-05-27, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage binding protein
    Species: Coccidioides immitis [TaxId:5501]
    Gene: MBP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ta_
  • Heterogens: EDO, CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n7tA (A:)
    gpgsmaplprkallaitsahppfwpdgkrtglffsealhpfneltaagfevdvasetgtf
    gwdehsltqeylskedekvlhsehnhfmekmnkqvfkagdlaphdyglmfvcgghgalyd
    fphakhlqniaqdiykrggvigavchgpamlpgihdengdsvikdktvtgfttkgeimik
    vidkmredhlhtiadmaqtanaeyvppedpwddfckvdgrivtganpqsatntardtikv
    yegivne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7tA (A:)
    plprkallaitsahppfwpdgkrtglffsealhpfneltaagfevdvasetgtfgwdehs
    ltqeylskedekvlhsehnhfmekmnkqvfkagdlaphdyglmfvcgghgalydfphakh
    lqniaqdiykrggvigavchgpamlpgihdengdsvikdktvtgfttkgeimikvidkmr
    edhlhtiadmaqtanaeyvppedpwddfckvdgrivtganpqsatntardtikvyegivn
    e