PDB entry 3n7q

View 3n7q on RCSB PDB site
Description: Crystal structure of human mitochondrial mTERF fragment (aa 99-399) in complex with a 12-mer DNA encompassing the tRNALeu(UUR) binding sequence
Deposited on 2010-05-27, released 2010-06-16
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription termination factor, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MTERF
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*gp*gp*cp*ap*gp*ap*gp*cp*cp*cp*gp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*cp*gp*gp*gp*cp*tp*cp*tp*gp*cp*c)-3')
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7qA (A:)
    mgsrmitneqdlkmfllskgaskeviasiisrypraitrtpenlskrwdlwrkivtsdle
    ivnilerspesffrsnnnlnlennikflysvgltrkclcrlltnaprtfsnsldlnkqmv
    eflqaaglslghndpadfvrkiifknpfiliqstkrvkanieflrstfnlnseellvlic
    gpgaeildlsndyarrsyanikeklfslgcteeevqkfvlsypdviflaekkfndkidcl
    meenisisqiienprvldssistlksrikelvnagcnlstlnitllswskkryeaklkkl
    srfahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n7qA (A:)
    mitneqdlkmfllskgaskeviasiisrypraitrtpenlskrwdlwrkivtsdleivni
    lerspesffrsnnnlnlennikflysvgltrkclcrlltnaprtfsnsldlnkqmveflq
    aaglslghndpadfvrkiifknpfiliqstkrvkanieflrstfnlnseellvlicgpga
    eildlsndyarrsyanikeklfslgcteeevqkfvlsypdviflaekkfndkidclmeen
    isisqiienprvldssistlksrikelvnagcnlstlnitllswskkryeaklkklsr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.