PDB entry 3n7n

View 3n7n on RCSB PDB site
Description: Structure of Csm1/Lrs4 complex
Deposited on 2010-05-27, released 2010-09-01
The last revision was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: 0.333
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Monopolin complex subunit LRS4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D9461.25, LRS4, YDR439W
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Monopolin complex subunit LRS4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D9461.25, LRS4, YDR439W
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7nA (A:)
    mdpltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkel
    ktqtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdykl
    gfvkgqaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    kkrekkdete
    

    Sequence, based on observed residues (ATOM records):
    >3n7nA (A:)
    pltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkelkt
    qtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthimdyklgfvvteviyap
    vlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n7nB (B:)
    mdpltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkel
    ktqtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdykl
    gfvkgqaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    kkrekkdete
    

    Sequence, based on observed residues (ATOM records):
    >3n7nB (B:)
    ltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkelktq
    tsqqaensevikdlyeylcnvrvhksyeddsglwfdisqimdyklgfvkgqaqvteviya
    pvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n7nC (C:)
    mdpltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkel
    ktqtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdykl
    gfvkgqaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    kkrekkdete
    

    Sequence, based on observed residues (ATOM records):
    >3n7nC (C:)
    knsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkelktqtsqq
    aensevikdlyeylcnvrvhksyeddsglwfdisqgthimdyklgfvvteviyapvlkqr
    steelyslqsklpeylfetlsfplsslnqfynkiaksl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n7nD (D:)
    mdpltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkel
    ktqtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdykl
    gfvkgqaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    kkrekkdete
    

    Sequence, based on observed residues (ATOM records):
    >3n7nD (D:)
    pltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkelkt
    qtsqqaensevikdlyeylcnvrvhksyeddsglwfdisimdyklgfvteviyapvlkqr
    steelyslqsklpeylfetlsfplsslnqfynkiaksl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n7nE (E:)
    mttllqllsnyykakldseriyneyvqsqyefasldkpkkvvdetlflqrqiaqlnkqlq
    lsfqenekllsvqknqkalyqsklsskdafiddlk
    

    Sequence, based on observed residues (ATOM records):
    >3n7nE (E:)
    tllqllsnyykakldseriyneyvqsqyefa
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n7nF (F:)
    mttllqllsnyykakldseriyneyvqsqyefasldkpkkvvdetlflqrqiaqlnkqlq
    lsfqenekllsvqknqkalyqsklsskdafiddlk
    

    Sequence, based on observed residues (ATOM records):
    >3n7nF (F:)
    tllqllsnyykakldseriyneyvqsqyef