PDB entry 3n7m

View 3n7m on RCSB PDB site
Description: Crystal structure of W1252A mutant of HCR D/C VPI 5995
Class: toxin
Keywords: Botulinum neurotoxin, W1252A mutant, GM1a, Ganglioside binding loop, TOXIN
Deposited on 2010-05-27, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: Clostridium Neurotoxin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LBR1
      • engineered mutation (390)
    Domains in SCOPe 2.07: d3n7ma1, d3n7ma2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n7mA (A:)
    nsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtq
    nenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqne
    nseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskt
    itfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnvvkdywgnd
    lrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrge
    nvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyya
    sqlflssnattnrlgilsigsysfklgddyafnheylipvikiehyaslleststhwvfv
    pase
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7mA (A:)
    sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
    enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
    seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
    tfqmnkipntglitninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydk
    eyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyf
    nttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlfl
    ssnattnrlgilsigsysfklgddyafnheylipvikiehyaslleststhwvfvpas