PDB entry 3n7l

View 3n7l on RCSB PDB site
Description: Crystal structure of botulinum neurotoxin serotype D/C VPI 5993 binding domain
Class: toxin
Keywords: Botulinum neurotoxin, HCR/D-SA, Ganglioside Binding Loop, TOXIN
Deposited on 2010-05-27, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: Clostridium Botulinum
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7la1, d3n7la2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n7lA (A:)
    nsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtq
    nenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqne
    nseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskt
    itfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnvvkdywgnd
    lrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrge
    nvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyya
    sqlflssnattnrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfv
    pase
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7lA (A:)
    sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
    enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
    seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
    tfqmnkipntglitninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydk
    eyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyf
    nttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlfl
    ssnattnrlgilsigsysfklgddywfnheylipvikiehyaslleststhwvfvpas