PDB entry 3n7h

View 3n7h on RCSB PDB site
Description: Crystal structure of Odorant Binding Protein 1 from Anopheles gambiae (AgamOBP1) with DEET (N,N-Diethyl-meta-toluamide) and PEG
Class: transport protein
Keywords: TRANSPORT PROTEIN, INSECT ODORANT BINDING PROTEIN, OBP1, AgamOBP1, DEET, N, N-Diethyl-meta-toluamide, OLFACTION
Deposited on 2010-05-27, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant binding protein
    Species: Anopheles gambiae [TaxId:7165]
    Gene: AgamOBP1, OBP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ha_
  • Chain 'B':
    Compound: odorant binding protein
    Species: Anopheles gambiae [TaxId:7165]
    Gene: AgamOBP1, OBP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7hb_
  • Heterogens: MG, MOH, DE3, PEU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n7hA (A:)
    dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
    eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
    hyflv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n7hB (B:)
    dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
    eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
    hyflv