PDB entry 3n7d

View 3n7d on RCSB PDB site
Description: crystal structure of copk bound to cu(i) and cu(ii)
Deposited on 2010-05-27, released 2011-06-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper resistance protein K
    Species: Cupriavidus metallidurans [TaxId:266264]
    Gene: copK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Copper resistance protein K
    Species: Cupriavidus metallidurans [TaxId:266264]
    Gene: copK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, CU1, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7dA (A:)
    vdmsnvvktydlqdgskvhvfkdgkmgmenkfgksmnmpegkvmetrdgtkiimkgneif
    rldealrkghsegg
    

    Sequence, based on observed residues (ATOM records):
    >3n7dA (A:)
    nvvktydlqdgskvhvfkdgkmgmenkfgksmnmpegkvmetrdgtkiimkgneifrld
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n7dB (B:)
    vdmsnvvktydlqdgskvhvfkdgkmgmenkfgksmnmpegkvmetrdgtkiimkgneif
    rldealrkghsegg
    

    Sequence, based on observed residues (ATOM records):
    >3n7dB (B:)
    vvktydlqdgskvhvfkmgmenkfgksmnmpegkvmetrdgtkiimkgneifrld