PDB entry 3n7c

View 3n7c on RCSB PDB site
Description: crystal structure of the ran binding domain from the nuclear pore complex component nup2 from ashbya gossypii
Deposited on 2010-05-26, released 2010-06-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABR034Wp
    Species: Ashbya gossypii [TaxId:33169]
    Gene: ABR034W, AGOS_ABR034W, NUP2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ABR034Wp
    Species: Ashbya gossypii [TaxId:33169]
    Gene: ABR034W, AGOS_ABR034W, NUP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7cA (A:)
    msltngeeneevlfcekakllifdsdtkgytsrgvgelkllrkkddkgkvrvlcrsegmg
    hvllntsvvksfkyqpidadnenlikwpiitdgkletfiikvkqkadgrrlvgavadaqq
    ameghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n7cA (A:)
    eevlfcekakllifdsgytsrgvgelkllrkkddkgkvrvlcrsgmghvllntsvvksfk
    yqpidadnenlikwpiitdgkletfiikvkqkadgrrlvgavadaqqam
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n7cB (B:)
    msltngeeneevlfcekakllifdsdtkgytsrgvgelkllrkkddkgkvrvlcrsegmg
    hvllntsvvksfkyqpidadnenlikwpiitdgkletfiikvkqkadgrrlvgavadaqq
    ameghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n7cB (B:)
    eevlfcekakllifgytsrgvgelkllrkkddkgkvrvlcrsghvllntsvvksfkyqpi
    dadnenlikwpiitletfiikvkqkadgrrlvgavadaqqam