PDB entry 3n7b

View 3n7b on RCSB PDB site
Description: SgrAI bound to secondary site DNA and Ca(II)
Deposited on 2010-05-26, released 2010-11-24
The last revision was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.176
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • engineered mutation (61)
  • Chain 'B':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • engineered mutation (61)
  • Chain 'C':
    Compound: DNA (5'-d(*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*gp*gp*gp*ap*cp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*gp*tp*cp*cp*cp*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n7bA (A:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3n7bA (A:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglar
    savhrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n7bB (B:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3n7bB (B:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrglglp
    tstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavafkr
    slrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglaegv
    hrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.