PDB entry 3n7a

View 3n7a on RCSB PDB site
Description: Crystal structure of 3-dehydroquinate dehydratase from Mycobacterium tuberculosis in complex with inhibitor 2
Class: lyase/lyase inhibitor
Keywords: dehydroquinate dehydratase, mycobacterium tuberculosis, shikimate pathway, drug discovery, LYASE, LYASE-LYASE INHIBITOR complex
Deposited on 2010-05-26, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7aa_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ab_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ac_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ad_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ae_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7af_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ag_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ah_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ai_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7aj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ak_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7al_
  • Chain 'M':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7am_
  • Chain 'N':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7an_
  • Chain 'O':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ao_
  • Chain 'P':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ap_
  • Chain 'Q':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7aq_
  • Chain 'R':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ar_
  • Chain 'S':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7as_
  • Chain 'T':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7at_
  • Chain 'U':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7au_
  • Chain 'V':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7av_
  • Chain 'W':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7aw_
  • Chain 'X':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ax_
  • Heterogens: FA1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n7aA (A:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aA (A:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n7aB (B:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aB (B:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n7aC (C:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aC (C:)
    livnvingpnlgrlgrrevyggtthdelvaliereaaelglkavvrqsdseaqlldwihq
    aadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgv
    ivglgiqgyllalrylaeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n7aD (D:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aD (D:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n7aE (E:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aE (E:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n7aF (F:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aF (F:)
    livnvingpnlgrlgrreggtthdelvaliereaaelglkavvrqsdseaqlldwihqaa
    daaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgviv
    glgiqgyllalrylaeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n7aG (G:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aG (G:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n7aH (H:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aH (H:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3n7aI (I:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aI (I:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3n7aJ (J:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aJ (J:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3n7aK (K:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aK (K:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3n7aL (L:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aL (L:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3n7aM (M:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aM (M:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3n7aN (N:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aN (N:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3n7aO (O:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aO (O:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3n7aP (P:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aP (P:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3n7aQ (Q:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aQ (Q:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3n7aR (R:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aR (R:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3n7aS (S:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aS (S:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3n7aT (T:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aT (T:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3n7aU (U:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aU (U:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3n7aV (V:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aV (V:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3n7aW (W:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aW (W:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaeh
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3n7aX (X:)
    mselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqll
    dwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylsp
    iatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7aX (X:)
    livnvingpnlgrlgrryggtthdelvaliereaaelglkavvrqsdseaqlldwihqaa
    daaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgviv
    glgiqgyllalrylaeh