PDB entry 3n79

View 3n79 on RCSB PDB site
Description: PduT C38S Mutant from Salmonella enterica Typhimurium
Class: electron transport
Keywords: FeS Cluster, BMC shell protein, Pdu, Carboxysome, ELECTRON TRANSPORT
Deposited on 2010-05-26, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PduT
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: pduT, STM2054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XDM8 (Start-183)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d3n79a1, d3n79a2
  • Heterogens: SO4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n79A (A:)
    msqaigileltsiakgmelgdamlksanvdllvsktispgkfllmlggdigaiqqaietg
    tsqagemlvdslvlanihpsvlpaisglnsvdkrqavgivetwsvaacisaadravkgsn
    vtlvrvhmafgiggkcymvvagdvsdvnnavtvasesagekgllvyrsviprpheamwrq
    mveglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n79A (A:)
    sqaigileltsiakgmelgdamlksanvdllvsktispgkfllmlggdigaiqqaietgt
    sqagemlvdslvlanihpsvlpaisglnsvdkrqavgivetwsvaacisaadravkgsnv
    tlvrvhmafgiggkcymvvagdvsdvnnavtvasesagekgllvyrsviprpheamwrqm
    veg