PDB entry 3n77

View 3n77 on RCSB PDB site
Description: crystal structure of idp01880, putative ntp pyrophosphohydrolase of salmonella typhimurium lt2
Deposited on 2010-05-26, released 2010-08-18
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside triphosphatase nudI
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: nudI, STM2295, yfaO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZNF5 (3-143)
      • engineered mutation (120)
      • engineered mutation (122-123)
  • Chain 'B':
    Compound: Nucleoside triphosphatase nudI
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: nudI, STM2295, yfaO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZNF5 (3-143)
      • engineered mutation (120)
      • engineered mutation (122-123)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n77A (A:)
    snamrqrtivcpliqndgcyllckmadnrgvfpgqwalsgggvepgerieealrreiree
    lgeqlilsditpwtfrddiriktyadgrqeeiymiylifdcvsanrdicindefqdyawv
    apaalalydlnvatrhtlalkgll
    

    Sequence, based on observed residues (ATOM records):
    >3n77A (A:)
    mrqrtivcpliqndgcyllckmadnrgvfpgqwalsgggvepgerieealrreireelge
    qlilsditpwtfrddiriktyadgrqeeiymiylifdcvsanrdicindefqdyawvapa
    alalydlnvatrhtlalkgll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n77B (B:)
    snamrqrtivcpliqndgcyllckmadnrgvfpgqwalsgggvepgerieealrreiree
    lgeqlilsditpwtfrddiriktyadgrqeeiymiylifdcvsanrdicindefqdyawv
    apaalalydlnvatrhtlalkgll
    

    Sequence, based on observed residues (ATOM records):
    >3n77B (B:)
    mrqrtivcpliqndgcyllckmadnrgvfpgqwalsgggvepgerieealrreireelge
    qlilsditpwtfrddiriktyadgrqeeiymiylifdcvsanrdicindefqdyawvapa
    alalydlnvatrhtlalkgll