PDB entry 3n75

View 3n75 on RCSB PDB site
Description: X-ray Crystal Structure of the Escherichia coli Inducible Lysine Decarboxylase LdcI
Deposited on 2010-05-26, released 2011-02-16
The last revision was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine decarboxylase, inducible
    Species: Escherichia coli [TaxId:83333]
    Gene: b4131, cadA, JW4092, ldcI, LdcI/CadA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lysine decarboxylase, inducible
    Species: Escherichia coli [TaxId:83333]
    Gene: b4131, cadA, JW4092, ldcI, LdcI/CadA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Lysine decarboxylase, inducible
    Species: Escherichia coli [TaxId:83333]
    Gene: b4131, cadA, JW4092, ldcI, LdcI/CadA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Lysine decarboxylase, inducible
    Species: Escherichia coli [TaxId:83333]
    Gene: b4131, cadA, JW4092, ldcI, LdcI/CadA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Lysine decarboxylase, inducible
    Species: Escherichia coli [TaxId:83333]
    Gene: b4131, cadA, JW4092, ldcI, LdcI/CadA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: G4P, P6G, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n75A (A:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlkeeskk
    

    Sequence, based on observed residues (ATOM records):
    >3n75A (A:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlke
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n75B (B:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlkeeskk
    

    Sequence, based on observed residues (ATOM records):
    >3n75B (B:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlke
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n75C (C:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlkeeskk
    

    Sequence, based on observed residues (ATOM records):
    >3n75C (C:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlke
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n75D (D:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlkeeskk
    

    Sequence, based on observed residues (ATOM records):
    >3n75D (D:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlke
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n75E (E:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlkeeskk
    

    Sequence, based on observed residues (ATOM records):
    >3n75E (E:)
    mnviailnhmgvyfkeepirelhralerlnfqivypndrddllkliennarlcgvifdwd
    kynlelceeiskmnenlplyafantystldvslndlrlqisffeyalgaaediankikqt
    tdeyintilppltkalfkyvregkytfctpghmggtafqkspvgslfydffgpntmksdi
    sisvselgslldhsgphkeaeqyiarvfnadrsymvtngtstankivgmysapagstili
    drnchkslthlmmmsdvtpiyfrptrnaygilggipqsefqhatiakrvketpnatwpvh
    avitnstydgllyntdfikktldvksihfdsawvpytnfspiyegkcgmsggrvegkviy
    etqsthkllaafsqasmihvkgdvneetfneaymmhtttsphygivastetaaammkgna
    gkrlingsieraikfrkeikrlrtesdgwffdvwqpdhidttecwplrsdstwhgfknid
    nehmyldpikvtlltpgmekdgtmsdfgipasivakyldehgivvektgpynllflfsig
    idktkalsllraltdfkrafdlnlrvknmlpslyredpefyenmriqelaqnihklivhh
    nlpdlmyrafevlptmvmtpyaafqkelhgmteevyldemvgrinanmilpyppgvplvm
    pgemiteesrpvleflqmlceigahypgfetdihgayrqadgrytvkvlke