PDB entry 3n74

View 3n74 on RCSB PDB site
Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from Brucella melitensis
Class: oxidoreductase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, brucellosis, orchitis, epididymitis, mastitis, oxidoreductase, NADP
Deposited on 2010-05-26, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-ketoacyl-(acyl-carrier-protein) reductase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: BAB2_0975
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YJS1 (4-255)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d3n74a_
  • Chain 'B':
    Compound: 3-ketoacyl-(acyl-carrier-protein) reductase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: BAB2_0975
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YJS1 (4-255)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d3n74b_
  • Chain 'C':
    Compound: 3-ketoacyl-(acyl-carrier-protein) reductase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: BAB2_0975
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YJS1 (4-255)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d3n74c_
  • Chain 'D':
    Compound: 3-ketoacyl-(acyl-carrier-protein) reductase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: BAB2_0975
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YJS1 (4-255)
      • engineered mutation (123)
    Domains in SCOPe 2.07: d3n74d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n74A (A:)
    gpgsmslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalav
    aadiskeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvy
    lmtskliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielap
    akirvvalnpvagetpllttfmgedseeirkkfrdsipmgrllkpddlaeaaaflcspqa
    smitgvaldvdggrsiggrsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n74A (A:)
    mslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalavaadi
    skeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvylmts
    kliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielapakir
    vvalnpvipmgrllkpddlaeaaaflcspqasmitgvaldvdggrsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n74B (B:)
    gpgsmslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalav
    aadiskeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvy
    lmtskliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielap
    akirvvalnpvagetpllttfmgedseeirkkfrdsipmgrllkpddlaeaaaflcspqa
    smitgvaldvdggrsiggrsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n74B (B:)
    mslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalavaadi
    skeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvylmts
    kliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielapakir
    vvalnpvipmgrllkpddlaeaaaflcspqasmitgvaldvdggrsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n74C (C:)
    gpgsmslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalav
    aadiskeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvy
    lmtskliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielap
    akirvvalnpvagetpllttfmgedseeirkkfrdsipmgrllkpddlaeaaaflcspqa
    smitgvaldvdggrsiggrsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n74C (C:)
    mslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalavaadi
    skeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvylmts
    kliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielapakir
    vvalnpvtfmgedssipmgrllkpddlaeaaaflcspqasmitgvaldvdggrsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n74D (D:)
    gpgsmslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalav
    aadiskeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvy
    lmtskliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielap
    akirvvalnpvagetpllttfmgedseeirkkfrdsipmgrllkpddlaeaaaflcspqa
    smitgvaldvdggrsiggrsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n74D (D:)
    mslegkvalitgagsgfgegmakrfakggakvvivdrdkagaervageigdaalavaadi
    skeadvdaaveaalskfgkvdilvnnagighkpqnaelvepeefdrivgvnvrgvylmts
    kliphfkengakgqecvilnvastgagrprpnlawynatkgwvvsvtkalaielapakir
    vvalnpvipmgrllkpddlaeaaaflcspqasmitgvaldvdggrsi