PDB entry 3n73

View 3n73 on RCSB PDB site
Description: Crystal structure of a putative 4-hydroxy-2-oxoglutarate aldolase from Bacillus cereus
Deposited on 2010-05-26, released 2010-06-09
The last revision was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.172
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative 4-hydroxy-2-oxoglutarate aldolase
    Species: Bacillus cereus [TaxId:222523]
    Gene: BCE_5001
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative 4-hydroxy-2-oxoglutarate aldolase
    Species: Bacillus cereus [TaxId:222523]
    Gene: BCE_5001
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n73A (A:)
    mtniqkrfykgrvalnvlannienakdifeaaegyvvvgvlskdyptveeavtamkaygk
    eiedavsiglgagdnrqaavvaeiakhypgshinqvfpsvgatranlggkdswinslvsp
    tgkvgyvnistgpisaageekaivpiktaialvrdmggnslkyfpmkglaheeeyravak
    acaeegfaleptggidkenfetivrialeanverviphvyssiidketgntkvedvrell
    avvkklvdqya
    

    Sequence, based on observed residues (ATOM records):
    >3n73A (A:)
    tniqkrfykgrvalnvlannienakdifeaaegyvvvgvlskdyptveeavtamkaygke
    iedavsiglgagdnrqaavvaeiakhypgshinqvfpsvgatranlggkdswinslvspt
    gkvgyvnistgpisaageekaivpiktaialvrdmggnslkyfpmkglaheeeyravaka
    caeegfaleptggidkenfetivrialeanverviphvyssiidketgntkvedvrella
    vvkklvdqya
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n73B (B:)
    mtniqkrfykgrvalnvlannienakdifeaaegyvvvgvlskdyptveeavtamkaygk
    eiedavsiglgagdnrqaavvaeiakhypgshinqvfpsvgatranlggkdswinslvsp
    tgkvgyvnistgpisaageekaivpiktaialvrdmggnslkyfpmkglaheeeyravak
    acaeegfaleptggidkenfetivrialeanverviphvyssiidketgntkvedvrell
    avvkklvdqya
    

    Sequence, based on observed residues (ATOM records):
    >3n73B (B:)
    tniqkrfykgrvalnvlannienakdifeaaegyvvvgvlskdyptveeavtamkaygke
    iedavsiglgagdnrqaavvaeiakhypgshinqvfpsvgatranlggkdswinslvspt
    gkvgyvnistgpisaageekaivpiktaialvrdmggnslkyfpmkglaheeeyravaka
    caeegfaleptggidkenfetivrialeanverviphvyssiidketgntkvedvrella
    vvkklvdqy