PDB entry 3n70

View 3n70 on RCSB PDB site
Description: the crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a
Deposited on 2010-05-26, released 2010-07-21
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Transport activator
    Species: Escherichia coli [TaxId:199310]
    Gene: c5204, pgtA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n70A (A:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70A (A:)
    igrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyreltpd
    napqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvelaas
    nhiiaelyycfamtqiaclplt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n70B (B:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70B (B:)
    qyrrrlqqlsetdiavwlygapgtrmtgarylhqreltpdnapqlndfialaqglshpeh
    ltreqqyhlvpfrligigdtslvelaasnhiiaelyycfamtqiaclp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n70C (C:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70C (C:)
    ewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyreltpdnaln
    dfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvelaasnhiiae
    lyycfamtqiac
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n70D (D:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70D (D:)
    rlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyreltpdnapqlndfiala
    qggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslveiaelyycfamtq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n70E (E:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70E (E:)
    rsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqefvyreltpdnap
    qlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvelaasnii
    aelyycfamtqiaclpl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n70F (F:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70F (F:)
    sewinqyrrrlqqlwlygapgtgrmtgarylhfvyreltpdnapqlndfialtlvlshpe
    hltreqqyhlvqlqsdtslvelaasnhiiaelyycfamtqiaclp
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3n70G (G:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70G (G:)
    qyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyreltpdnapqlndf
    ialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvelaasiiaelyyc
    famtqiac
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3n70H (H:)
    veligrsewinqyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyrel
    tpdnapqlndfialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvel
    aasnhiiaelyycfamtqiaclplt
    

    Sequence, based on observed residues (ATOM records):
    >3n70H (H:)
    qyrrrlqqlsetdiavwlygapgtgrmtgarylhqfgrnaqgefvyreltpdnapqlndf
    ialaqggtlvlshpehltreqqyhlvqlqsqehrpfrligigdtslvelaasnhiiaely
    yc