PDB entry 3n6y

View 3n6y on RCSB PDB site
Description: crystal structure of an immunoglobulin-like protein (pa1606) from pseudomonas aeruginosa at 1.50 a resolution
Deposited on 2010-05-26, released 2010-07-21
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin-like protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1606
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3B5 (1-136)
      • leader sequence (0)
  • Chain 'B':
    Compound: immunoglobulin-like protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1606
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3B5 (1-136)
      • leader sequence (0)
  • Heterogens: PG4, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n6yA (A:)
    gaqaevridgpieygvfesryqdfqpgervltrseqniqqttevpaklgtkfgmryqlsg
    kqegdtpltllyltpgvvtpdgqrhdkfevvqklvpgaptdvmayeftephevvkgewrl
    mvfqgdrllaeksfdvr
    

    Sequence, based on observed residues (ATOM records):
    >3n6yA (A:)
    gaqaevridgpieygvfesrseqniqqttevpaklgtkfgmryqlsgkqegdtpltllyl
    tpgvvtpdgqrhdkfevvqklvpgaptdvmayeftephevvkgewrlmvfqgdrllaeks
    fdvr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n6yB (B:)
    gaqaevridgpieygvfesryqdfqpgervltrseqniqqttevpaklgtkfgmryqlsg
    kqegdtpltllyltpgvvtpdgqrhdkfevvqklvpgaptdvmayeftephevvkgewrl
    mvfqgdrllaeksfdvr
    

    Sequence, based on observed residues (ATOM records):
    >3n6yB (B:)
    gaqaevridgpieygvfesseqniqqttevpaklgtkfgmryqlsgkqegdtpltllylt
    pgvvtpdgqrhdkfevvqklvpgaptdvmayeftephevvkgewrlmvfqgdrllaeksf
    dvr