PDB entry 3n6x

View 3n6x on RCSB PDB site
Description: crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
Deposited on 2010-05-26, released 2010-06-09
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glutathionylspermidine synthase
    Species: Methylobacillus flagellatus [TaxId:265072]
    Gene: Mfla_0391
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n6xA (A:)
    gmdtaktkpfdemflqdevirpiyaeyaawlqdvphqqleskrqeaellfrrvgitfnvy
    gedagaerlipfdvvprilsasewarlsdgaiqrvkalnmflhdvyhdqeiikagivpss
    ilanaqyrpemfgvdvpggvyahiagvdlvrtgendfyvlednlrtpsgvsymlenrkmm
    mrlfpelfrrypvapvehypqvllnnlravaqagvheptvvlltpgaynsayfehafiaq
    qmgielvegqdlfvrnnavymrttegpkrvdviyrridddfidplsfrpdsmlgvpglls
    vyrnggvtlanavgtgvaddkdtyiyvpemirfylgeepilsnvptyqlskaddlkyvld
    nlaelvvkevqgsggygmlvgpaaskqeledfrqrilanpanyiaqptlalstcptlvet
    giaprhvdlrpfvlsgktvslvpgalcrvalregslvvnssqgggtkdtwilkd
    

    Sequence, based on observed residues (ATOM records):
    >3n6xA (A:)
    tkpfdemflqdevirpiyaeyaawlqdvphqqleskrqeaellfrrvgitflipfdvvpr
    ilsasewarlsdgaiqrvkalnmflhdvyhdqeiikagivpssilanaqyrpemfgvdvp
    ggvyahiagvdlvrtgendfyvlednlrtpsgvsymlenrkmmmrlfpelfrrypvapve
    hypqvllnnlravaqagvheptvvlltpgaynsayfehafiaqqmgielvegqdlfvrnn
    avymrttegpkrvdviyrridddfidplsfrpdsmlgvpgllsvyrnggvtlanavgtgv
    addkdtyiyvpemirfylgeepilsnvptyqlskaddlkyvldnlaelvvkevqgmlvgp
    aaskqeledfrqrilanpanyiaqptlalstcptlvetgiaprhvdlrpfvlsgktvslv
    pgalcrvalregslvvnssqgggtkdtwilk