PDB entry 3n6w

View 3n6w on RCSB PDB site
Description: Crystal structure of human gamma-butyrobetaine hydroxylase
Class: oxidoreductase
Keywords: gamma-butyrobetaine hydroxylase, bbh, dioxygenase, carnitine, HYDROLASE, OXIDOREDUCTASE
Deposited on 2010-05-26, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-butyrobetaine dioxygenase
    Species: Homo sapiens [TaxId:9606]
    Gene: BBH, BBOX, BBOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75936 (16-End)
      • expression tag (15)
    Domains in SCOPe 2.07: d3n6wa1, d3n6wa2, d3n6wa3
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n6wA (A:)
    mnhkvhhhhhhiegrsmactiqkaealdgahlmqilwydeeeslypavwlrdncpcsdcy
    ldsakarkllvealdvnigikglifdrkkvyitwpdehysefqadwlkkrcfskqarakl
    qrelffpecqywgselqlptldfedvlrydehaykwlstlkkvgivrltgasdkpgevsk
    lgkrmgflyltfyghtwqvqdkidannvayttgklsfhtdypalhhppgvqllhcikqtv
    tggdseivdgfnvcqklkknnpqafqilsstfvdftdigvdycdfsvqskhkiielddkg
    qvvrinfnnatrdtifdvpvervqpfyaalkefvdlmnskeskftfkmnpgdvitfdnwr
    llhgrrsyeagteisrhlegayadwdvvmsrlrilrqrvengn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6wA (A:)
    smactiqkaealdgahlmqilwydeeeslypavwlrdncpcsdcyldsakarkllveald
    vnigikglifdrkkvyitwpdehysefqadwlkkrcfskqaraklqrelffpecqywgse
    lqlptldfedvlrydehaykwlstlkkvgivrltgasdkpgevsklgkrmgflyltfygh
    twqvqdklsfhtdypalhhppgvqllhcikqdseivdgfnvcqklkknnpqafqilsstf
    vdftdigvdycdfsvqskhkiielddkgqvvrinfnnatrdtifdvpvervqpfyaalke
    fvdlmnskeskftfkmnpgdvitfdnwrllhgrrrhlegayadwdvvmsrlrilrqrven