PDB entry 3n6u

View 3n6u on RCSB PDB site
Description: Effector binding domain of TsaR in complex with its inducer p-toluenesulfonate
Deposited on 2010-05-26, released 2011-06-01
The last revision was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.222
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysR type regulator of tsaMBCD
    Species: Comamonas testosteroni [TaxId:285]
    Gene: tsa, tsaR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, TSU, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n6uA (A:)
    ghitfaaspaialaalplalasfarefpdvtvnvrdgmypavspqlrdgtldfaltaahk
    hdidtdleaqplyvsdvvivgqrqhpmanatrlaelqecrwafssaprgpgaiirnafar
    yglpepklglvcesflalpgvvahsdllttmprtlyernafkdqlcsiplqdalpnptiy
    vlrrhdlpvtpaaaglirwiqhhal