PDB entry 3n6s

View 3n6s on RCSB PDB site
Description: Crystal structure of human mitochondrial mTERF in complex with a 15-mer DNA encompassing the tRNALeu(UUR) binding sequence
Deposited on 2010-05-26, released 2010-06-16
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription termination factor, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MTERF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99551 (Start-346)
      • expression tag (347-348)
  • Chain 'B':
    Compound: DNA (5'-d(*ap*tp*gp*gp*cp*ap*gp*ap*gp*cp*cp*cp*gp*gp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*cp*gp*gp*gp*cp*tp*cp*tp*gp*cp*cp*a)-3')

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n6sA (A:)
    masrlfgvkchntdseplknedllknlltmgvdidmarkrqpgvfhrmitneqdlkmfll
    skgaskeviasiisrypraitrtpenlskrwdlwrkivtsdleivnilerspesffrsnn
    nlnlennikflysvgltrkclcrlltnaprtfsnsldlnkqmveflqaaglslghndpad
    fvrkiifknpfiliqstkrvkanieflrstfnlnseellvlicgpgaeildlsndyarrs
    yanikeklfslgcteeevqkfvlsypdviflaekkfndkidclmeenisisqiienprvl
    dssistlksrikelvnagcnlstlnitllswskkryeaklkklsrfahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n6sA (A:)
    fgvkchntdseplknedllknlltmgvdidmarkrqpgvfhrmitneqdlkmfllskgas
    keviasiisrypraitrtpenlskrwdlwrkivtsdleivnilerspesffrsnnnlnle
    nnikflysvgltrkclcrlltnaprtfsnsldlnkqmveflqaaglslghndpadfvrki
    ifknpfiliqstkrvkanieflrstfnlnseellvlicgpgaeildlsndyarrsyanik
    eklfslgcteeevqkfvlsypdviflaekkfndkidclmeenisisqiienprvldssis
    tlksrikelvnagcnlstlnitllswskkryeaklkklsrfahh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.