PDB entry 3n6r

View 3n6r on RCSB PDB site
Description: crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc)
Deposited on 2010-05-26, released 2010-08-25
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.212
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Propionyl-CoA carboxylase, alpha subunit
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: pccA, SPO1101
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: propionyl-CoA carboxylase, beta subunit
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: pccB, RD1_2028
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Propionyl-CoA carboxylase, alpha subunit
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: pccA, SPO1101
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: propionyl-CoA carboxylase, beta subunit
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: pccB, RD1_2028
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Propionyl-CoA carboxylase, alpha subunit
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: pccA, SPO1101
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: propionyl-CoA carboxylase, beta subunit
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: pccB, RD1_2028
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Propionyl-CoA carboxylase, alpha subunit
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: pccA, SPO1101
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: propionyl-CoA carboxylase, beta subunit
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: pccB, RD1_2028
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Propionyl-CoA carboxylase, alpha subunit
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: pccA, SPO1101
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: propionyl-CoA carboxylase, beta subunit
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: pccB, RD1_2028
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Propionyl-CoA carboxylase, alpha subunit
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: pccA, SPO1101
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: propionyl-CoA carboxylase, beta subunit
    Species: Roseobacter denitrificans [TaxId:375451]
    Gene: pccB, RD1_2028
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BTI

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n6rA (A:)
    mfnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsy
    ividkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitsk
    kiaqeanvstvpgymgliedadeavkisnqigypvmikasaggggkgmriawndqeareg
    fqsskneaansfgddrifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvve
    eapspfldeatrramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvt
    elitgvdlveqmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrp
    paetaagpllvngkwqgdapsgeaavrndtgvyeggeismyydpmiaklctwaptraaai
    eamrialdsfevegighnlpflsavmdhpkfisgdmttafiaeeypegfegvnlpetdlr
    rvaaaaaamhrvaeirrtrvsgrmdnherrvgtewvvtlqgadfpvtiaadhdgstvsfd
    dgssmrvtsdwtpgdqlanlmvdgaplvlkvgkisggfrirtrgadlkvhvrtprqaela
    rlmpeklppdtskmllcpmpglivkvdvevgqevqegqalctieamkmenilraekkgvv
    akinasagnslavddvimefe
    

    Sequence, based on observed residues (ATOM records):
    >3n6rA (A:)
    fnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsyi
    vidkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitskk
    iaqeanvstvpgvtqprhieiqvlcdshgngiylgerecsiqrrnqkvveeapspfldea
    trramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvtelitgvdlve
    qmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrppaeaavrndt
    gvyeggeismyydpmiaklctwaptraaaieamrialdsfevegighnlpflsavmdhpk
    fisgdmttafiaeeypegfegvnlpetdlrrvaaaaaamhrvaeirrtrvsgrmdnherr
    vgtewvvtlqgadfpvtiaadhdgstvsfddgssmrvtsdwtpgdqlanlmvdgaplvlk
    vgkisggfrirtrgadlkvhvrtprqaelarlmpeklppdtskmllcpmpglivkvdvev
    gqevqegqalctieamkmenilraekkgvvakinasagnslavddvimefe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n6rB (B:)
    mgsshhhhhhssglvprgshmmkdileqledrraaarlgggqkridaqhgrgkltarerv
    dllldegsfeefdmfvthrctdfnmqdqkpagdgvvtgwgtingrvvyvfsqdftvlggs
    vsethskkickimdmamqngapvigindsggariqegvdslagygevfqrnimasgvvpq
    ismimgpcaggavyspamtdfifmvkdssymfvtgpdvvktvtneqvsaeelggatthtr
    kssvadaafendvealaevrrlvdflplnnrekppvrpffddpdriepsldtlvpdnpnt
    pydmkelihkladegdfyeiqeefakniitgfirlegrtvgvvanqplvlagcldidssr
    kaarfvrfcdafeiplltlidvpgflpgtsqeyggvikhgakllyaygeatvpmvtvitr
    kayggayvvmsskhlradfnyawptaevavmgakgateiihrgdlgdpekiaqhtadyee
    rfanpfvasergfvdeviqprstrkrvarafaslrnksvqmpwkkhdnipl
    

    Sequence, based on observed residues (ATOM records):
    >3n6rB (B:)
    leqledrraaarlgggqkridaqhgrgkltarervdllldegsfeefdmfvthrctdfnm
    qdqkpagdgvvtgwgtingrvvyvfsqdftvlggsvsethskkickimdmamqngapvig
    indsggariqegvdslagygevfqrnimasgvvpqismimgpcaggavyspamtdfifmv
    kdssymfvtgpdvvktvtneqvsaeelggatthtrkssvadaafendvealaevrrlvdf
    lplnnrekppvrpffddpdriepsldtlvpdnpntpydmkelihkladegdfyeiqeefa
    kniitgfirlegrtvgvvanqplvlagcldidssrkaarfvrfcdafeiplltlidvpgf
    lpgtsqeyggvikhgakllyaygeatvpmvtvitrkayggayvvmsskhlradfnyawpt
    aevavmgakgateiihrgdlgdpekiaqhtadyeerfanpfvasergfvdeviqprstrk
    rvarafaslrnksvqmpwkkhdnipl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n6rC (C:)
    mfnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsy
    ividkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitsk
    kiaqeanvstvpgymgliedadeavkisnqigypvmikasaggggkgmriawndqeareg
    fqsskneaansfgddrifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvve
    eapspfldeatrramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvt
    elitgvdlveqmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrp
    paetaagpllvngkwqgdapsgeaavrndtgvyeggeismyydpmiaklctwaptraaai
    eamrialdsfevegighnlpflsavmdhpkfisgdmttafiaeeypegfegvnlpetdlr
    rvaaaaaamhrvaeirrtrvsgrmdnherrvgtewvvtlqgadfpvtiaadhdgstvsfd
    dgssmrvtsdwtpgdqlanlmvdgaplvlkvgkisggfrirtrgadlkvhvrtprqaela
    rlmpeklppdtskmllcpmpglivkvdvevgqevqegqalctieamkmenilraekkgvv
    akinasagnslavddvimefe
    

    Sequence, based on observed residues (ATOM records):
    >3n6rC (C:)
    fnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsyi
    vidkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitskk
    iaqeanvstvpgvtqprhieiqvlcdshgngiylgerecsiqrrnqkvveeapspfldea
    trramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvtelitgvdlve
    qmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrppaeaavrndt
    gvyeggeismyydpmiaklctwaptraaaieamrialdsfevegighnlpflsavmdhpk
    fisgdmttafiaeeypegfegvnlpetdlrrvaaaaaamhrvaeirrtrvsgrmdnherr
    vgtewvvtlqgadfpvtiaadhdgstvsfddgssmrvtsdwtpgdqlanlmvdgaplvlk
    vgkisggfrirtrgadlkvhvrtprqaelarlmpeklppdtskmllcpmpglivkvdvev
    gqevqegqalctieamkmenilraekkgvvakinasagnslavddvimefe
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n6rD (D:)
    mgsshhhhhhssglvprgshmmkdileqledrraaarlgggqkridaqhgrgkltarerv
    dllldegsfeefdmfvthrctdfnmqdqkpagdgvvtgwgtingrvvyvfsqdftvlggs
    vsethskkickimdmamqngapvigindsggariqegvdslagygevfqrnimasgvvpq
    ismimgpcaggavyspamtdfifmvkdssymfvtgpdvvktvtneqvsaeelggatthtr
    kssvadaafendvealaevrrlvdflplnnrekppvrpffddpdriepsldtlvpdnpnt
    pydmkelihkladegdfyeiqeefakniitgfirlegrtvgvvanqplvlagcldidssr
    kaarfvrfcdafeiplltlidvpgflpgtsqeyggvikhgakllyaygeatvpmvtvitr
    kayggayvvmsskhlradfnyawptaevavmgakgateiihrgdlgdpekiaqhtadyee
    rfanpfvasergfvdeviqprstrkrvarafaslrnksvqmpwkkhdnipl
    

    Sequence, based on observed residues (ATOM records):
    >3n6rD (D:)
    leqledrraaarlgggqkridaqhgrgkltarervdllldegsfeefdmfvthrctdfnm
    qdqkpagdgvvtgwgtingrvvyvfsqdftvlggsvsethskkickimdmamqngapvig
    indsggariqegvdslagygevfqrnimasgvvpqismimgpcaggavyspamtdfifmv
    kdssymfvtgpdvvktvtneqvsaeelggatthtrkssvadaafendvealaevrrlvdf
    lplnnrekppvrpffddpdriepsldtlvpdnpntpydmkelihkladegdfyeiqeefa
    kniitgfirlegrtvgvvanqplvlagcldidssrkaarfvrfcdafeiplltlidvpgf
    lpgtsqeyggvikhgakllyaygeatvpmvtvitrkayggayvvmsskhlradfnyawpt
    aevavmgakgateiihrgdlgdpekiaqhtadyeerfanpfvasergfvdeviqprstrk
    rvarafaslrnksvqmpwkkhdnipl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n6rE (E:)
    mfnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsy
    ividkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitsk
    kiaqeanvstvpgymgliedadeavkisnqigypvmikasaggggkgmriawndqeareg
    fqsskneaansfgddrifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvve
    eapspfldeatrramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvt
    elitgvdlveqmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrp
    paetaagpllvngkwqgdapsgeaavrndtgvyeggeismyydpmiaklctwaptraaai
    eamrialdsfevegighnlpflsavmdhpkfisgdmttafiaeeypegfegvnlpetdlr
    rvaaaaaamhrvaeirrtrvsgrmdnherrvgtewvvtlqgadfpvtiaadhdgstvsfd
    dgssmrvtsdwtpgdqlanlmvdgaplvlkvgkisggfrirtrgadlkvhvrtprqaela
    rlmpeklppdtskmllcpmpglivkvdvevgqevqegqalctieamkmenilraekkgvv
    akinasagnslavddvimefe
    

    Sequence, based on observed residues (ATOM records):
    >3n6rE (E:)
    fnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsyi
    vidkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitskk
    iaqeanvstvpgvtqprhieiqvlcdshgngiylgerecsiqrrnqkvveeapspfldea
    trramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvtelitgvdlve
    qmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrppaeaavrndt
    gvyeggeismyydpmiaklctwaptraaaieamrialdsfevegighnlpflsavmdhpk
    fisgdmttafiaeeypegfegvnlpetdlrrvaaaaaamhrvaeirrtrvsgrmdnherr
    vgtewvvtlqgadfpvtiaadhdgstvsfddgssmrvtsdwtpgdqlanlmvdgaplvlk
    vgkisggfrirtrgadlkvhvrtprqaelarlmpeklppdtskmllcpmpglivkvdvev
    gqevqegqalctieamkmenilraekkgvvakinasagnslavddvimefe
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n6rF (F:)
    mgsshhhhhhssglvprgshmmkdileqledrraaarlgggqkridaqhgrgkltarerv
    dllldegsfeefdmfvthrctdfnmqdqkpagdgvvtgwgtingrvvyvfsqdftvlggs
    vsethskkickimdmamqngapvigindsggariqegvdslagygevfqrnimasgvvpq
    ismimgpcaggavyspamtdfifmvkdssymfvtgpdvvktvtneqvsaeelggatthtr
    kssvadaafendvealaevrrlvdflplnnrekppvrpffddpdriepsldtlvpdnpnt
    pydmkelihkladegdfyeiqeefakniitgfirlegrtvgvvanqplvlagcldidssr
    kaarfvrfcdafeiplltlidvpgflpgtsqeyggvikhgakllyaygeatvpmvtvitr
    kayggayvvmsskhlradfnyawptaevavmgakgateiihrgdlgdpekiaqhtadyee
    rfanpfvasergfvdeviqprstrkrvarafaslrnksvqmpwkkhdnipl
    

    Sequence, based on observed residues (ATOM records):
    >3n6rF (F:)
    leqledrraaarlgggqkridaqhgrgkltarervdllldegsfeefdmfvthrctdfnm
    qdqkpagdgvvtgwgtingrvvyvfsqdftvlggsvsethskkickimdmamqngapvig
    indsggariqegvdslagygevfqrnimasgvvpqismimgpcaggavyspamtdfifmv
    kdssymfvtgpdvvktvtneqvsaeelggatthtrkssvadaafendvealaevrrlvdf
    lplnnrekppvrpffddpdriepsldtlvpdnpntpydmkelihkladegdfyeiqeefa
    kniitgfirlegrtvgvvanqplvlagcldidssrkaarfvrfcdafeiplltlidvpgf
    lpgtsqeyggvikhgakllyaygeatvpmvtvitrkayggayvvmsskhlradfnyawpt
    aevavmgakgateiihrgdlgdpekiaqhtadyeerfanpfvasergfvdeviqprstrk
    rvarafaslrnksvqmpwkkhdnipl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3n6rG (G:)
    mfnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsy
    ividkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitsk
    kiaqeanvstvpgymgliedadeavkisnqigypvmikasaggggkgmriawndqeareg
    fqsskneaansfgddrifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvve
    eapspfldeatrramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvt
    elitgvdlveqmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrp
    paetaagpllvngkwqgdapsgeaavrndtgvyeggeismyydpmiaklctwaptraaai
    eamrialdsfevegighnlpflsavmdhpkfisgdmttafiaeeypegfegvnlpetdlr
    rvaaaaaamhrvaeirrtrvsgrmdnherrvgtewvvtlqgadfpvtiaadhdgstvsfd
    dgssmrvtsdwtpgdqlanlmvdgaplvlkvgkisggfrirtrgadlkvhvrtprqaela
    rlmpeklppdtskmllcpmpglivkvdvevgqevqegqalctieamkmenilraekkgvv
    akinasagnslavddvimefe
    

    Sequence, based on observed residues (ATOM records):
    >3n6rG (G:)
    fnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsyi
    vidkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitskk
    iaqeanvstvpgymgliedadeavkisnqigypvmikasamriawndqearegfqssknd
    rifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvveeapspfldeatrram
    geqavalakavgyasagtvefivdgqknfyflemntrlqvehpvtelitgvdlveqmirv
    aageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrppaeaavrndtgvyeg
    geismyydpmiaklctwaptraaaieamrialdsfevegighnlpflsavmdhpkfisgd
    mttafiaeeypegfegvnlpetdlrrvaaaaaamhrvaeirrtrvsgrmdnherrvgtew
    vvtlqgadfpvtiaadhdgstvsfddgssmrvtsdwtpgdqlanlmvdgaplvlkvgkis
    ggfrirtrgadlkvhvrtprqaelarlmpeklppdtskmllcpmpglivkvdvevgqevq
    egqalctieamkmenilraekkgvvakinasagnslavddvimefe
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3n6rH (H:)
    mgsshhhhhhssglvprgshmmkdileqledrraaarlgggqkridaqhgrgkltarerv
    dllldegsfeefdmfvthrctdfnmqdqkpagdgvvtgwgtingrvvyvfsqdftvlggs
    vsethskkickimdmamqngapvigindsggariqegvdslagygevfqrnimasgvvpq
    ismimgpcaggavyspamtdfifmvkdssymfvtgpdvvktvtneqvsaeelggatthtr
    kssvadaafendvealaevrrlvdflplnnrekppvrpffddpdriepsldtlvpdnpnt
    pydmkelihkladegdfyeiqeefakniitgfirlegrtvgvvanqplvlagcldidssr
    kaarfvrfcdafeiplltlidvpgflpgtsqeyggvikhgakllyaygeatvpmvtvitr
    kayggayvvmsskhlradfnyawptaevavmgakgateiihrgdlgdpekiaqhtadyee
    rfanpfvasergfvdeviqprstrkrvarafaslrnksvqmpwkkhdnipl
    

    Sequence, based on observed residues (ATOM records):
    >3n6rH (H:)
    leqledrraaarlgggqkridaqhgrgkltarervdllldegsfeefdmfvthrctdfnm
    qdqkpagdgvvtgwgtingrvvyvfsqdftvlggsvsethskkickimdmamqngapvig
    indsggariqegvdslagygevfqrnimasgvvpqismimgpcaggavyspamtdfifmv
    kdssymfvtgpdvvktvtneqvsaeelggatthtrkssvadaafendvealaevrrlvdf
    lplnnrekppvrpffddpdriepsldtlvpdnpntpydmkelihkladegdfyeiqeefa
    kniitgfirlegrtvgvvanqplvlagcldidssrkaarfvrfcdafeiplltlidvpgf
    lpgtsqeyggvikhgakllyaygeatvpmvtvitrkayggayvvmsskhlradfnyawpt
    aevavmgakgateiihrgdlgdpekiaqhtadyeerfanpfvasergfvdeviqprstrk
    rvarafaslrnksvqmpwkkhdnipl
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3n6rI (I:)
    mfnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsy
    ividkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitsk
    kiaqeanvstvpgymgliedadeavkisnqigypvmikasaggggkgmriawndqeareg
    fqsskneaansfgddrifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvve
    eapspfldeatrramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvt
    elitgvdlveqmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrp
    paetaagpllvngkwqgdapsgeaavrndtgvyeggeismyydpmiaklctwaptraaai
    eamrialdsfevegighnlpflsavmdhpkfisgdmttafiaeeypegfegvnlpetdlr
    rvaaaaaamhrvaeirrtrvsgrmdnherrvgtewvvtlqgadfpvtiaadhdgstvsfd
    dgssmrvtsdwtpgdqlanlmvdgaplvlkvgkisggfrirtrgadlkvhvrtprqaela
    rlmpeklppdtskmllcpmpglivkvdvevgqevqegqalctieamkmenilraekkgvv
    akinasagnslavddvimefe
    

    Sequence, based on observed residues (ATOM records):
    >3n6rI (I:)
    fnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsyi
    vidkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitskk
    iaqeanvstvpgymgliedadeavkisnqigypvmikasamriawndqearegfqssknd
    rifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvveeapspfldeatrram
    geqavalakavgyasagtvefivdgqknfyflemntrlqvehpvtelitgvdlveqmirv
    aageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrppaeaavrndtgvyeg
    geismyydpmiaklctwaptraaaieamrialdsfevegighnlpflsavmdhpkfisgd
    mttafiaeeypegfegvnlpetdlrrvaaaaaamhrvaeirrtrvsgrmdnherrvgtew
    vvtlqgadfpvtiaadhdgstvsfddgssmrvtsdwtpgdqlanlmvdgaplvlkvgkis
    ggfrirtrgadlkvhvrtprqaelarlmpeklppdtskmllcpmpglivkvdvevgqevq
    egqalctieamkmenilraekkgvvakinasagnslavddvimefe
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3n6rJ (J:)
    mgsshhhhhhssglvprgshmmkdileqledrraaarlgggqkridaqhgrgkltarerv
    dllldegsfeefdmfvthrctdfnmqdqkpagdgvvtgwgtingrvvyvfsqdftvlggs
    vsethskkickimdmamqngapvigindsggariqegvdslagygevfqrnimasgvvpq
    ismimgpcaggavyspamtdfifmvkdssymfvtgpdvvktvtneqvsaeelggatthtr
    kssvadaafendvealaevrrlvdflplnnrekppvrpffddpdriepsldtlvpdnpnt
    pydmkelihkladegdfyeiqeefakniitgfirlegrtvgvvanqplvlagcldidssr
    kaarfvrfcdafeiplltlidvpgflpgtsqeyggvikhgakllyaygeatvpmvtvitr
    kayggayvvmsskhlradfnyawptaevavmgakgateiihrgdlgdpekiaqhtadyee
    rfanpfvasergfvdeviqprstrkrvarafaslrnksvqmpwkkhdnipl
    

    Sequence, based on observed residues (ATOM records):
    >3n6rJ (J:)
    leqledrraaarlgggqkridaqhgrgkltarervdllldegsfeefdmfvthrctdfnm
    qdqkpagdgvvtgwgtingrvvyvfsqdftvlggsvsethskkickimdmamqngapvig
    indsggariqegvdslagygevfqrnimasgvvpqismimgpcaggavyspamtdfifmv
    kdssymfvtgpdvvktvtneqvsaeelggatthtrkssvadaafendvealaevrrlvdf
    lplnnrekppvrpffddpdriepsldtlvpdnpntpydmkelihkladegdfyeiqeefa
    kniitgfirlegrtvgvvanqplvlagcldidssrkaarfvrfcdafeiplltlidvpgf
    lpgtsqeyggvikhgakllyaygeatvpmvtvitrkayggayvvmsskhlradfnyawpt
    aevavmgakgateiihrgdlgdpekiaqhtadyeerfanpfvasergfvdeviqprstrk
    rvarafaslrnksvqmpwkkhdnipl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3n6rK (K:)
    mfnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsy
    ividkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitsk
    kiaqeanvstvpgymgliedadeavkisnqigypvmikasaggggkgmriawndqeareg
    fqsskneaansfgddrifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvve
    eapspfldeatrramgeqavalakavgyasagtvefivdgqknfyflemntrlqvehpvt
    elitgvdlveqmirvaageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrp
    paetaagpllvngkwqgdapsgeaavrndtgvyeggeismyydpmiaklctwaptraaai
    eamrialdsfevegighnlpflsavmdhpkfisgdmttafiaeeypegfegvnlpetdlr
    rvaaaaaamhrvaeirrtrvsgrmdnherrvgtewvvtlqgadfpvtiaadhdgstvsfd
    dgssmrvtsdwtpgdqlanlmvdgaplvlkvgkisggfrirtrgadlkvhvrtprqaela
    rlmpeklppdtskmllcpmpglivkvdvevgqevqegqalctieamkmenilraekkgvv
    akinasagnslavddvimefe
    

    Sequence, based on observed residues (ATOM records):
    >3n6rK (K:)
    fnkilianrgeiacrviktarkmgistvaiysdadkqalhvqmadeavhigpppanqsyi
    vidkvmaairatgaqavhpgygflsenskfaealeaegvifvgppkgaieamgdkitskk
    iaqeanvstvpgymgliedadeavkisnqigypvmikasamriawndqearegfqssknd
    rifiekfvtqprhieiqvlcdshgngiylgerecsiqrrnqkvveeapspfldeatrram
    geqavalakavgyasagtvefivdgqknfyflemntrlqvehpvtelitgvdlveqmirv
    aageplsitqgdvkltgwaienrlyaedpyrgflpsigrltryrppaeaavrndtgvyeg
    geismyydpmiaklctwaptraaaieamrialdsfevegighnlpflsavmdhpkfisgd
    mttafiaeeypegfegvnlpetdlrrvaaaaaamhrvaeirrtrvsgrmdnherrvgtew
    vvtlqgadfpvtiaadhdgstvsfddgssmrvtsdwtpgdqlanlmvdgaplvlkvgkis
    ggfrirtrgadlkvhvrtprqaelarlmpeklppdtskmllcpmpglivkvdvevgqevq
    egqalctieamkmenilraekkgvvakinasagnslavddvimefe
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3n6rL (L:)
    mgsshhhhhhssglvprgshmmkdileqledrraaarlgggqkridaqhgrgkltarerv
    dllldegsfeefdmfvthrctdfnmqdqkpagdgvvtgwgtingrvvyvfsqdftvlggs
    vsethskkickimdmamqngapvigindsggariqegvdslagygevfqrnimasgvvpq
    ismimgpcaggavyspamtdfifmvkdssymfvtgpdvvktvtneqvsaeelggatthtr
    kssvadaafendvealaevrrlvdflplnnrekppvrpffddpdriepsldtlvpdnpnt
    pydmkelihkladegdfyeiqeefakniitgfirlegrtvgvvanqplvlagcldidssr
    kaarfvrfcdafeiplltlidvpgflpgtsqeyggvikhgakllyaygeatvpmvtvitr
    kayggayvvmsskhlradfnyawptaevavmgakgateiihrgdlgdpekiaqhtadyee
    rfanpfvasergfvdeviqprstrkrvarafaslrnksvqmpwkkhdnipl
    

    Sequence, based on observed residues (ATOM records):
    >3n6rL (L:)
    leqledrraaarlgggqkridaqhgrgkltarervdllldegsfeefdmfvthrctdfnm
    qdqkpagdgvvtgwgtingrvvyvfsqdftvlggsvsethskkickimdmamqngapvig
    indsggariqegvdslagygevfqrnimasgvvpqismimgpcaggavyspamtdfifmv
    kdssymfvtgpdvvktvtneqvsaeelggatthtrkssvadaafendvealaevrrlvdf
    lplnnrekppvrpffddpdriepsldtlvpdnpntpydmkelihkladegdfyeiqeefa
    kniitgfirlegrtvgvvanqplvlagcldidssrkaarfvrfcdafeiplltlidvpgf
    lpgtsqeyggvikhgakllyaygeatvpmvtvitrkayggayvvmsskhlradfnyawpt
    aevavmgakgateiihrgdlgdpekiaqhtadyeerfanpfvasergfvdeviqprstrk
    rvarafaslrnksvqmpwkkhdnipl