PDB entry 3n6q

View 3n6q on RCSB PDB site
Description: Crystal structure of YghZ from E. coli
Class: oxidoreductase
Keywords: TIM barrel, OXIDOREDUCTASE
Deposited on 2010-05-26, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qa_
  • Chain 'B':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qb_
  • Chain 'C':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qc_
  • Chain 'D':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qd_
  • Chain 'E':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qe_
  • Chain 'F':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qf_
  • Chain 'G':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qg_
  • Chain 'H':
    Compound: YghZ aldo-keto reductase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6qh_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n6qA (A:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qA (A:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkyllteanl
    nslrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstke
    laqidqhiadgeln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n6qB (B:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qB (B:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylmltean
    lnslrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstk
    elaqidqhiadgeln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n6qC (C:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qC (C:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylteanln
    slrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkel
    aqidqhiadgeln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n6qD (D:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qD (D:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkyllteanl
    nslrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstke
    laqidqhiadgelnl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n6qE (E:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qE (E:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkeanlnslr
    llnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkelaqi
    dqhiadgel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n6qF (F:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qF (F:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylteanln
    slrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkel
    aqidqhiadgeln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n6qG (G:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qG (G:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylteanln
    slrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkel
    aqidqhiadgeln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n6qH (H:)
    mvwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithf
    dlannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasl
    dqslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmve
    llrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipq
    dsrmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvli
    gasraeqleenvqalnnltfstkelaqidqhiadgelnlwqassdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6qH (H:)
    vwlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfd
    lannygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasld
    qslkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvel
    lrewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgklteanlns
    lrllnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkela
    qidqhi