PDB entry 3n6o

View 3n6o on RCSB PDB site
Description: Crystal structure of the GEF and P4M domain of DrrA/SidM from Legionella pneumophila
Deposited on 2010-05-26, released 2010-07-28
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.173
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange factor
    Species: Legionella pneumophila [TaxId:272624]
    Gene: DrrA, lpg2464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSQ3 (3-End)
      • expression tag (0-2)
  • Chain 'B':
    Compound: guanine nucleotide exchange factor
    Species: Legionella pneumophila [TaxId:272624]
    Gene: DrrA, lpg2464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSQ3 (3-End)
      • expression tag (0-2)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n6oA (A:)
    ghmvtrienlenakklwdnansmlekgnisgylkaanelhkfmkeknlkeddlrpelsdk
    tispkgyailqslwgaasdysraaatltestvepglvsavnkmsaffmdcklspneratp
    dpdfkvgkskilvgimqfikdvadptskiwmhntkalmnhkiaaiqklersnnvndetle
    svlsskgenlseylsykyatkdegrehrytastenfknvkekyqqmrgdalkteiladfk
    dklaeatdeqslkqivaelkskdeyrilakgqglttqllglktssvssfekmveetresi
    ksqerqtikik
    

    Sequence, based on observed residues (ATOM records):
    >3n6oA (A:)
    ghmvtrienlenakklwdnansmlekgnisgylkaanelhkfmkeknlkeddlrpelsdk
    tispkgyailqslwgaasdysraaatltestvepglvsavnkmsaffmdcklspneratp
    dpdfkvgkskilvgimqfikdvadptskiwmhntkalmnhkiaaiqklersnnvndetle
    svlsskgenlseylsykyatkdegrehrytastenfknvkekyqqmrgdalkteiladfk
    dklaeatdeqslkqivaelkskdeyrilakgqglttqllglktssvssfekmveetresi
    ksq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n6oB (B:)
    ghmvtrienlenakklwdnansmlekgnisgylkaanelhkfmkeknlkeddlrpelsdk
    tispkgyailqslwgaasdysraaatltestvepglvsavnkmsaffmdcklspneratp
    dpdfkvgkskilvgimqfikdvadptskiwmhntkalmnhkiaaiqklersnnvndetle
    svlsskgenlseylsykyatkdegrehrytastenfknvkekyqqmrgdalkteiladfk
    dklaeatdeqslkqivaelkskdeyrilakgqglttqllglktssvssfekmveetresi
    ksqerqtikik
    

    Sequence, based on observed residues (ATOM records):
    >3n6oB (B:)
    ghmvtrienlenakklwdnansmlekgnisgylkaanelhkfmkeknlkeddlrpelsdk
    tispkgyailqslwgaasdysraaatltestvepglvsavnkmsaffmdcklspneratp
    dpdfkvgkskilvgimqfikdvadptskiwmhntkalmnhkiaaiqklersnnvndetle
    svlsskgenlseylsykyatkdegrehrytastenfknvkekyqqmrgdalkteiladfk
    dklaeatdeqslkqivaelkskdeyrilakgqglttqllglktssvssfekmveetresi
    k