PDB entry 3n6h

View 3n6h on RCSB PDB site
Description: Crystal structure of Mandelate racemase/muconate lactonizing protein from Actinobacillus succinogenes 130Z complexed with magnesium/sulfate
Class: isomerase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, enolase, PSI-2, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2010-05-25, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VQF6 (Start-446)
      • expression tag (447)
    Domains in SCOPe 2.07: d3n6ha1, d3n6ha2, d3n6ha3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VQF6 (Start-446)
      • expression tag (447-448)
    Domains in SCOPe 2.07: d3n6hb1, d3n6hb2, d3n6hb3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6hc1, d3n6hc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VQF6 (Start-446)
      • expression tag (447)
    Domains in SCOPe 2.07: d3n6hd1, d3n6hd2, d3n6hd3
  • Heterogens: SO4, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n6hA (A:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6hA (A:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhnawtfelrvnavaaleaalldlmgqflgvpvaellgp
    gkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdr
    ygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlty
    aedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwt
    ltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyl
    tknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfd
    rkrpamvre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n6hB (B:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6hB (B:)
    qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
    lteaiphvvgrpisilnkivndmhngywtfelrvnavaaleaalldlmgqflgvpvaell
    gpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaask
    drygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvl
    tyaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphf
    wtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdf
    yltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwk
    fdrkrpamvreg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n6hC (C:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6hC (C:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellgpgk
    qrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdryg
    fkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyae
    dpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwtlt
    gasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyltk
    npleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfdrk
    rpamvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n6hD (D:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6hD (D:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhelrvnavaaleaalldlmgqflgvpvaellgpgkqrd
    evtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdrygfkd
    fklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyaedpc
    igengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwtltgas
    rvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyltknpl
    eikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfdrkrpa
    mvre