PDB entry 3n5x

View 3n5x on RCSB PDB site
Description: Structure of neuronal nitric oxide synthase heme domain in complex with 4-(2-(5-(2-(6-amino-4-methylpyridin-2-yl)ethyl)pyridin-3-yl)ethyl)-6-methylpyridin-2-amine
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: heme enzyme, nitric oxide synthase, substrate inhibitor, Zn binding', OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-05-25, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitric oxide synthase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n5xa_
  • Chain 'B':
    Compound: nitric oxide synthase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NOS3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n5xb_
  • Heterogens: HEM, XFK, ACT, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n5xA (A:)
    cprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5xA (A:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlptkdqlfplakefldqyyssi
    krfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvfda
    rdcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqpd
    gstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpirhp
    kfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynilee
    vakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrcr
    ggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n5xB (B:)
    cprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5xB (B:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
    sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
    dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
    pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
    hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
    eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
    crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg