PDB entry 3n5u

View 3n5u on RCSB PDB site
Description: Crystal structure of an Rb C-terminal peptide bound to the catalytic subunit of PP1
Deposited on 2010-05-25, released 2010-08-11
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.225
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1A, PPP1CA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1A, PPP1CA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Retinoblastoma-associated protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, CL

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n5uA (A:)
    msdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplk
    icgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffl
    lrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdl
    qsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhd
    ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

    Sequence, based on observed residues (ATOM records):
    >3n5uA (A:)
    lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
    gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
    casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
    rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
    ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n5uB (B:)
    msdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplk
    icgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffl
    lrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdl
    qsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhd
    ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

    Sequence, based on observed residues (ATOM records):
    >3n5uB (B:)
    lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
    gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
    casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
    rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
    ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n5uC (C:)
    kplkklrfdiegs
    

    Sequence, based on observed residues (ATOM records):
    >3n5uC (C:)
    kklrfdi