PDB entry 3n5o

View 3n5o on RCSB PDB site
Description: Crystal structure of putative glutathione transferase from Coccidioides immitis bound to glutathione
Deposited on 2010-05-25, released 2010-06-16
The last revision was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.16
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase
    Species: Coccidioides immitis [TaxId:5501]
    Gene: COI
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: glutathione transferase
    Species: Coccidioides immitis [TaxId:5501]
    Gene: COI
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GSH, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n5oA (A:)
    gpgsmttpnfelygyfrsscsgrlriafhlksipytrhpvnllkgeqhsdtykslnptnt
    vpllvvsninntvspssasfsigqslaaleyleealptnarpllppisnpvarahvrtic
    niiacdvqpvtnlkiqkkvkaldgdptvwsrdlatqgfgavekllelsagrfcvgdeitl
    advclvpavwaaervgmdlarfpitkrvfeemlkeeavqkahwqkqedtpedlra
    

    Sequence, based on observed residues (ATOM records):
    >3n5oA (A:)
    tpnfelygyfrsscsgrlriafhlksipytrhpvnllkgeqhsdtykslnptntvpllvv
    sninntvspssasfsigqslaaleyleealptnarpllppisnpvarahvrticniiacd
    vqpvtnlkiqkkvkaldgdptvwsrdlatqgfgavekllelsagrfcvgdeitladvclv
    pavwaaervgmdlarfpitkrvfeemlkeeavqkahwqkqedtpedlr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n5oB (B:)
    gpgsmttpnfelygyfrsscsgrlriafhlksipytrhpvnllkgeqhsdtykslnptnt
    vpllvvsninntvspssasfsigqslaaleyleealptnarpllppisnpvarahvrtic
    niiacdvqpvtnlkiqkkvkaldgdptvwsrdlatqgfgavekllelsagrfcvgdeitl
    advclvpavwaaervgmdlarfpitkrvfeemlkeeavqkahwqkqedtpedlra
    

    Sequence, based on observed residues (ATOM records):
    >3n5oB (B:)
    tpnfelygyfrsscsgrlriafhlksipytrhpvnllntvpllvvsninntvspssasfs
    igqslaaleyleealptnarpllppisnpvarahvrticniiacdvqpvtnlkiqkkvka
    ldgdptvwsrdlatqgfgavekllelsagrfcvgdeitladvclvpavwaaervgmdlar
    fpitkrvfeemlkeeavqkahwqkqedtpedlra