PDB entry 3n5n

View 3n5n on RCSB PDB site
Description: Crystal structure analysis of the catalytic domain and interdomain connector of human MutY homologue
Deposited on 2010-05-25, released 2010-11-10
The last revision was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: A/G-specific adenine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MUTYH, MYH
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: A/G-specific adenine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MUTYH, MYH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3n5nX (X:)
    asvssyhlfrdvaevtafrgsllswydqekrdlpwrrraedemdldrrayavwvsevmlq
    qtqvatvinyytgwmqkwptlqdlasasleevnqlwaglgyysrgrrlqegarkvveelg
    ghmprtaetlqqllpgvgrytagaiasiafgqatgvvdgnvarvlcrvraigadpsstlv
    sqqlwglaqqlvdparpgdfnqaamelgatvctpqrplcsqcpveslcrarqrveqeqll
    asgslsgspdveecapntgqchlclppsepwdqtlgvvnfprkasrk
    

    Sequence, based on observed residues (ATOM records):
    >3n5nX (X:)
    ssyhlfrdvaevtafrgsllswydqekrdlpwrrraedemdldrrayavwvsevmlqqtq
    vatvinyytgwmqkwptlqdlasasleevnqlwaglgyysrgrrlqegarkvveelgghm
    prtaetlqqllpgvgrytagaiasiafgqatgvvdgnvarvlcrvraigadpsstlvsqq
    lwglaqqlvdparpgdfnqaamelgatvctpqrplcsqcpveslcrarqrveqeqllasg
    slveecapntgqchlclppsepwdqtlgvvn
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >3n5nY (Y:)
    asvssyhlfrdvaevtafrgsllswydqekrdlpwrrraedemdldrrayavwvsevmlq
    qtqvatvinyytgwmqkwptlqdlasasleevnqlwaglgyysrgrrlqegarkvveelg
    ghmprtaetlqqllpgvgrytagaiasiafgqatgvvdgnvarvlcrvraigadpsstlv
    sqqlwglaqqlvdparpgdfnqaamelgatvctpqrplcsqcpveslcrarqrveqeqll
    asgslsgspdveecapntgqchlclppsepwdqtlgvvnfprkasrk
    

    Sequence, based on observed residues (ATOM records):
    >3n5nY (Y:)
    ssyhlfrdvaevtafrgsllswydqekrdlpwrrraedemdldrrayavwvsevmlqqtq
    vatvinyytgwmqkwptlqdlasasleevnqlwaglgyysrgrrlqegarkvveelgghm
    prtaetlqqllpgvgrytagaiasiafgqatgvvdgnvarvlcrvraigadpsstlvsqq
    lwglaqqlvdparpgdfnqaamelgatvctpqrplcsqcpveslcrarqrveqeqllasg
    slsveecapntgqchlclppsepwdqtlgvvn