PDB entry 3n5l

View 3n5l on RCSB PDB site
Description: crystal structure of a binding protein component of abc phosphonate transporter (pa3383) from pseudomonas aeruginosa at 1.97 a resolution
Deposited on 2010-05-25, released 2010-06-02
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Binding protein component of ABC phosphonate transporter
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA3383
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYL8 (1-End)
      • see remark 999 (247)
  • Chain 'B':
    Compound: Binding protein component of ABC phosphonate transporter
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA3383
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYL8 (1-End)
      • see remark 999 (247)
  • Heterogens: UNL, SO4, EDO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n5lA (A:)
    gdqpvinfgiistessqnlksiwepflkdmsqqtgyqvkaffapdyagiiqgmrfdkvdi
    awygnkaameavdrahgeifaqtvaasgapgywslliankdskidsledmlanaksltfg
    ngdpnstsgylvpgyyvfaknnvdpvkafkrtlnsshevnalavankqvdvatfntegme
    rleltqpekarqlkviwksplipgdplvwrnnlsdeqknklrdfffkyganaeqkkvlad
    lqwskfqasdddqllpirqlelfkqrtdvannanlgaeekaaklkaldeelaklekrmae
    reqktaanag
    

    Sequence, based on observed residues (ATOM records):
    >3n5lA (A:)
    dqpvinfgiistessqnlksiwepflkdmsqqtgyqvkaffapdyagiiqgmrfdkvdia
    wygnkaameavdrahgeifaqtvaasgapgywslliankdskidsledmlanaksltfgn
    gdpnstsgylvpgyyvfaknnvdpvkafkrtlnsshevnalavankqvdvatfntegmer
    leltqpekarqlkviwksplipgdplvwrnnlsdeqknklrdfffkyganaeqkkvladl
    qwskfqasdddqllpirqlelfkqrtdvannanlgaeekaaklkaldeelaklekrmaer
    eqktaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n5lB (B:)
    gdqpvinfgiistessqnlksiwepflkdmsqqtgyqvkaffapdyagiiqgmrfdkvdi
    awygnkaameavdrahgeifaqtvaasgapgywslliankdskidsledmlanaksltfg
    ngdpnstsgylvpgyyvfaknnvdpvkafkrtlnsshevnalavankqvdvatfntegme
    rleltqpekarqlkviwksplipgdplvwrnnlsdeqknklrdfffkyganaeqkkvlad
    lqwskfqasdddqllpirqlelfkqrtdvannanlgaeekaaklkaldeelaklekrmae
    reqktaanag
    

    Sequence, based on observed residues (ATOM records):
    >3n5lB (B:)
    dqpvinfgiistessqnlksiwepflkdmsqqtgyqvkaffapdyagiiqgmrfdkvdia
    wygnkaameavdrahgeifaqtvaasgapgywslliankdskidsledmlanaksltfgn
    gdpnstsgylvpgyyvfaknnvdpvkafkrtlnsshevnalavankqvdvatfntegmer
    leltqpekarqlkviwksplipgdplvwrnnlsdeqknklrdfffkyganaeqkkvladl
    qwskfqasdddqllpirqlelfkqrtdvannanlgaeekaaklkaldeelaklekrmaer
    eq