PDB entry 3n5i

View 3n5i on RCSB PDB site
Description: Crystal structure of the precursor (S250A mutant) of the N-terminal beta-aminopeptidase BapA
Class: hydrolase
Keywords: Ntn hydrolase, alpha-beta-beta-alpha sandwich, beta-aminopeptidase, beta-peptide, HYDROLASE
Deposited on 2010-05-25, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52VH2 (0-End)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d3n5ia_
  • Chain 'B':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52VH2 (0-End)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d3n5ib_
  • Chain 'C':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52VH2 (0-End)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d3n5ic_
  • Chain 'D':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52VH2 (0-End)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d3n5id_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n5iA (A:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknalliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5iA (A:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivknal
    liviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplggkprlpa
    iindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlarimkarfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n5iB (B:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknalliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5iB (B:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivknal
    liviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplggkprlpa
    iindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlarimkarfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n5iC (C:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknalliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5iC (C:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaakn
    alliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplggkprl
    paiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlarimkar
    fp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n5iD (D:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknalliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5iD (D:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknalliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfp