PDB entry 3n5f

View 3n5f on RCSB PDB site
Description: Crystal Structure of L-N-carbamoylase from Geobacillus stearothermophilus CECT43
Deposited on 2010-05-25, released 2011-05-25
The last revision was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamoyl-L-amino acid hydrolase
    Species: Bacillus stearothermophilus [TaxId:1422]
    Gene: amaB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: N-carbamoyl-L-amino acid hydrolase
    Species: Bacillus stearothermophilus [TaxId:1422]
    Gene: amaB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IPA, CO, CAC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n5fA (A:)
    miqgerlwqrlmelgevgkqpsggvtrlsftaeerrakdlvasymreaglfvyedaagnl
    igrkegtnpdatvvlvgshldsvynggcfdgplgvlagvevvqtmnehgvvthhpievva
    ftdeegarfrfgmigsramagtlppealecrdaegislaeamkqagldpdrlpqaarkpg
    tvkayvelhieqgrvleetglpvgivtgiagliwvkftiegkaehagatpmslrrdpmaa
    aaqiiivieeearrtgttvgtvgqlhvypgginvipervefvldlrdlkaevrdqvwkai
    avraetiakernvrvtterlqemppvlcsdevkraaeaacqklgypsfwlpsgaahdsvq
    lapicpigmifvrsqdgvshspaewstkedcaagaevlyhtvwqlaqg
    

    Sequence, based on observed residues (ATOM records):
    >3n5fA (A:)
    qgerlwqrlmelgevgkqpsggvtrlsftaeerrakdlvasymreaglfvyedaagnlig
    rkegtnpdatvvlvgshldsvynggcfdgplgvlagvevvqtmnehgvvthhpievvaft
    deegarfrfgmigsramagtlppealecrdaegislaeamkqagldpdrlpqaarkpgtv
    kayvelhieqgrvleetglpvgivtgiagliwvkftiegkaehagatpmslrrdpmaaaa
    qiiivieeearrtgttvgtvgqlhvypgginvipervefvldlrdlkaevrdqvwkaiav
    raetiakernvrvtterlqemppvlcsdevkraaeaacqklgypsfwlpsgaahdsvqla
    picpigmifvrsqdgvshspaewstkedcaagaevlyhtvwqlaqg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n5fB (B:)
    miqgerlwqrlmelgevgkqpsggvtrlsftaeerrakdlvasymreaglfvyedaagnl
    igrkegtnpdatvvlvgshldsvynggcfdgplgvlagvevvqtmnehgvvthhpievva
    ftdeegarfrfgmigsramagtlppealecrdaegislaeamkqagldpdrlpqaarkpg
    tvkayvelhieqgrvleetglpvgivtgiagliwvkftiegkaehagatpmslrrdpmaa
    aaqiiivieeearrtgttvgtvgqlhvypgginvipervefvldlrdlkaevrdqvwkai
    avraetiakernvrvtterlqemppvlcsdevkraaeaacqklgypsfwlpsgaahdsvq
    lapicpigmifvrsqdgvshspaewstkedcaagaevlyhtvwqlaqg
    

    Sequence, based on observed residues (ATOM records):
    >3n5fB (B:)
    qgerlwqrlmelgevgkqpsggvtrlsftaeerrakdlvasymreaglfvyedaagnlig
    rkegtnpdatvvlvgshldsvynggcfdgplgvlagvevvqtmnehgvvthhpievvaft
    deegarfrfgmigsramagtlppealecrdaegislaeamkqagldpdrlpqaarkpgtv
    kayvelhieqgrvleetglpvgivtgiagliwvkftiegkaehagatpmslrrdpmaaaa
    qiiivieeearrtgttvgtvgqlhvypgginvipervefvldlrdlkaevrdqvwkaiav
    raetiakernvrvtterlqemppvlcsdevkraaeaacqklgypsfwlpsgaahdsvqla
    picpigmifvrsqdgvshspaewstkedcaagaevlyhtvwqlaqg