PDB entry 3n5c

View 3n5c on RCSB PDB site
Description: Crystal Structure of Arf6DELTA13 complexed with GDP
Class: protein transport
Keywords: Small G protein ; Small GTP-binding protein, Arf, ADP-ribosylation factor 6, Traffic, ENDOCYTOSIS, UNFOLDED PROTEIN, PROTEIN TRANSPORT
Deposited on 2010-05-25, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.172
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n5ca_
  • Chain 'B':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n5cb_
  • Heterogens: GDP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n5cA (A:)
    mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
    wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
    eiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5cA (A:)
    mrilmlgldaagkttilyklklgqsvyknvkfnvwdvggqdkirplwrhyytgtqglifv
    vdcadrdridearqelhriindremrdaiilifankqdlpdamkpheiqeklgltrirdr
    nwyvqpscatsgdglyegltwltsnyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n5cB (B:)
    mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
    wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
    eiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5cB (B:)
    mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
    wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
    eiqeklgltrirdrnwyvqpscatsgdglyegltwltsny