PDB entry 3n5b

View 3n5b on RCSB PDB site
Description: The complex of PII and PipX from Anabaena
Deposited on 2010-05-24, released 2010-09-01
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: Nostoc [TaxId:103690]
    Gene: all2319, glnB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Asr0485 protein
    Species: Nostoc [TaxId:103690]
    Gene: asr0485
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n5bA (A:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    veivvednqvdmvvdkiiaaartgeigdgkifispveqvirirtgeknteav
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n5bB (B:)
    mgsshhhhhhssglvprgshmnpensetyinhptwgllyricmvdesqdlfttlyaqrlf
    flvgndikaikfqpigrtearmllenrlrnlrrngqsqeydqlqsvfqrtfq
    

    Sequence, based on observed residues (ATOM records):
    >3n5bB (B:)
    setyinhptwgllyricmvdesqdlfttlyaqrlfflvgndikaikfqpigrtearmlle
    nrlrnlrrngqsqeydqlqsvfqrtf