PDB entry 3n59

View 3n59 on RCSB PDB site
Description: Type II dehydroquinase from Mycobacterium Tuberculosis complexed with 3-dehydroshikimate
Class: lyase
Keywords: DEHYDRATASE, SHIKIMATE PATHWAY, LYASE, AROMATIC AMINO ACID BIOSYNTHESIS, tuberculosis, drug target, 3-dehydroshikimate, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2010-05-24, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59a_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59b_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59c_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59d_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59e_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59f_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59g_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59h_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59i_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59j_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59k_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59l_
  • Chain 'M':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Z6 (25-End)
      • expression tag (18-24)
    Domains in SCOPe 2.06: d3n59m1, d3n59m2
  • Chain 'N':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59n_
  • Chain 'O':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59o_
  • Chain 'P':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59p_
  • Chain 'Q':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59q_
  • Chain 'R':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59r_
  • Chain 'S':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59s_
  • Chain 'T':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59t_
  • Chain 'U':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59u_
  • Chain 'V':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59v_
  • Chain 'W':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59w_
  • Chain 'X':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n59x_
  • Heterogens: CL, 3DS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n59A (A:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59A (A:)
    livnvingpnlgrlgrreyggtthdelvaliereaaelglkavvrqsdseaqlldwihqa
    adaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvi
    vglgiqgyllalrylaehv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n59B (B:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59B (B:)
    livnvingpnlgrlgryggtthdelvaliereaaelglkavvrqsdseaqlldwihqaad
    aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg
    lgiqgyllalrylaeh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n59C (C:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59C (C:)
    elivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
    ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
    tgvivglgiqgyllalrylaeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n59D (D:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59D (D:)
    elivnvingpnlgrlgryggtthdelvaliereaaelglkavvrqsdseaqlldwihqaa
    daaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgviv
    glgiqgyllalrylaehv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n59E (E:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59E (E:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaehv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n59F (F:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59F (F:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n59G (G:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59G (G:)
    livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
    hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
    gvivglgiqgyllalrylaehv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n59H (H:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59H (H:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3n59I (I:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59I (I:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3n59J (J:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59J (J:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3n59K (K:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59K (K:)
    livnvingpnlgrlgrreggtthdelvaliereaaelglkavvrqsdseaqlldwihqaa
    daaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgviv
    glgiqgyllalrylaeh
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3n59L (L:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59L (L:)
    livnvingpnlgrlgrreggtthdelvaliereaaelglkavvrqsdseaqlldwihqaa
    daaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgviv
    glgiqgyllalrylaehv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3n59M (M:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59M (M:)
    nlyfqshmselivnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaql
    ldwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsyls
    piatgvivglgiqgyllalrylaehv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3n59N (N:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59N (N:)
    livnvingpnlgrlgryggtthdelvaliereaaelglkavvrqsdseaqlldwihqaad
    aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg
    lgiqgyllalrylaeh
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3n59O (O:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59O (O:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3n59P (P:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59P (P:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3n59Q (Q:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59Q (Q:)
    livnvingpnlgrlgrreyggtthdelvaliereaaelglkavvrqsdseaqlldwihqa
    adaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvi
    vglgiqgyllalrylaeh
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3n59R (R:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59R (R:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3n59S (S:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59S (S:)
    elivnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaad
    aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg
    lgiqgyllalrylaeh
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3n59T (T:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59T (T:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3n59U (U:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59U (U:)
    elivnvingpnlgrlgrgtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3n59V (V:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59V (V:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3n59W (W:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59W (W:)
    livnvingpnlgrlgrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaada
    aepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivgl
    giqgyllalrylaeh
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3n59X (X:)
    mgsshhhhhhssglqgtenlyfqshmselivnvingpnlgrlgrrepavyggtthdelva
    liereaaelglkavvrqsdseaqlldwihqaadaaepvilnagglthtsvalrdacaels
    aplievhisnvhareefrrhsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n59X (X:)
    livnvingpnlgrlgrvyggtthdelvaliereaaelglkavvrqsdseaqlldwihqaa
    daaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgviv
    glgiqgyllalrylaeh