PDB entry 3n58

View 3n58 on RCSB PDB site
Description: crystal structure of s-adenosyl-l-homocysteine hydrolase from brucella melitensis in ternary complex with nad and adenosine, orthorhombic form
Deposited on 2010-05-24, released 2010-06-02
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylhomocysteinase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ahcY, BAB1_2099
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQX8 (5-463)
      • expression tag (4)
  • Chain 'B':
    Compound: Adenosylhomocysteinase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ahcY, BAB1_2099
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQX8 (5-463)
      • expression tag (3-4)
  • Chain 'C':
    Compound: Adenosylhomocysteinase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ahcY, BAB1_2099
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQX8 (5-463)
      • expression tag (3-4)
  • Chain 'D':
    Compound: Adenosylhomocysteinase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ahcY, BAB1_2099
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQX8 (5-463)
      • expression tag (3-4)
  • Heterogens: K, ADN, NAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n58A (A:)
    gpgsmvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtav
    lietlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpd
    gepsnmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkq
    raaikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrg
    tdvmmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaa
    stadivvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdli
    efpdgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpk
    hldekvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

    Sequence, based on observed residues (ATOM records):
    >3n58A (A:)
    mvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtavliet
    lkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpdgeps
    nmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkqraai
    kgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrgtdvm
    magkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaastad
    ivvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdliefpd
    gkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpkhlde
    kvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n58B (B:)
    gpgsmvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtav
    lietlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpd
    gepsnmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkq
    raaikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrg
    tdvmmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaa
    stadivvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdli
    efpdgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpk
    hldekvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

    Sequence, based on observed residues (ATOM records):
    >3n58B (B:)
    smvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtavlie
    tlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpdgep
    snmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkqraa
    ikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrgtdv
    mmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaasta
    divvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdliefp
    dgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpkhld
    ekvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n58C (C:)
    gpgsmvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtav
    lietlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpd
    gepsnmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkq
    raaikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrg
    tdvmmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaa
    stadivvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdli
    efpdgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpk
    hldekvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

    Sequence, based on observed residues (ATOM records):
    >3n58C (C:)
    smvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtavlie
    tlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpdgep
    snmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkqraa
    ikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrgtdv
    mmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaasta
    divvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdliefp
    dgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpkhld
    ekvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n58D (D:)
    gpgsmvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtav
    lietlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpd
    gepsnmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkq
    raaikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrg
    tdvmmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaa
    stadivvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdli
    efpdgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpk
    hldekvarlhldklgakltvlseeqaayigvtpqgpfksehyry
    

    Sequence, based on observed residues (ATOM records):
    >3n58D (D:)
    smvvkdisladwgrkeldiaetempglmaareefgksqplkgarisgslhmtiqtavlie
    tlkvlgaevrwascnifstqdhaaaaiaatgtpvfavkgetleeywtytdqifqwpdgep
    snmilddggdatmyiligaraeagedvlsnpqseeeevlfaqikkrmaatpgfftkqraa
    ikgvteetttgvnrlyqlqkkgllpfpainvndsvtkskfdnkygckeslvdgirrgtdv
    mmagkvavvcgygdvgkgsaqslagagarvkvtevdpicalqaamdgfevvtlddaasta
    divvtttgnkdvitidhmrkmkdmcivgnighfdneiqvaalrnlkwtnvkpqvdliefp
    dgkrlillsegrllnlgnatghpsfvmsasftnqvlgqielftrtdayknevyvlpkhld
    ekvarlhldklgakltvlseeqaayigvtpqgpfksehyry