PDB entry 3n56

View 3n56 on RCSB PDB site
Description: crystal structure of human insulin-degrading enzyme (ide) in complex with human b-type natriuretic peptide (bnp)
Deposited on 2010-05-24, released 2010-11-17
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-degrading enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_1810909, IDE, RP11-366I13.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14735
      • engineered mutation (80-81)
      • engineered mutation (141)
      • engineered mutation (148)
      • engineered mutation (227)
      • engineered mutation (384)
      • engineered mutation (543)
      • engineered mutation (560)
      • engineered mutation (759)
      • engineered mutation (782)
      • engineered mutation (789)
      • engineered mutation (874)
  • Chain 'B':
    Compound: Insulin-degrading enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_1810909, IDE, RP11-366I13.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14735
      • engineered mutation (80-81)
      • engineered mutation (141)
      • engineered mutation (148)
      • engineered mutation (227)
      • engineered mutation (384)
      • engineered mutation (543)
      • engineered mutation (560)
      • engineered mutation (759)
      • engineered mutation (782)
      • engineered mutation (789)
      • engineered mutation (874)
  • Chain 'C':
    Compound: Natriuretic peptides B
    Species: Homo sapiens [TaxId:9606]
    Gene: NPPB
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Natriuretic peptides B
    Species: Homo sapiens [TaxId:9606]
    Gene: NPPB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, DIO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n56A (A:)
    mhhhhhhaagipmnnpaikrignhitkspedkreyrglelangikvllisdpttdkssaa
    ldvhigslsdppniaglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtny
    yfdvshehlegaldrfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatg
    npkhpfskfgtgnkytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltn
    lvvklfsevenknvplpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksn
    pghylghlighegpgsllselkskgwvntlvggqkegargfmffiinvdlteegllhved
    iilhmfqyiqklraegpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleev
    ltaeylleefrpdliemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdev
    ikkwqnadlngkfklptknefiptnfeilplekeatpypalikdtamsklwfkqddkffl
    pkanlnfeffspfayvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmyl
    svkgyndkqpillkkiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrll
    mtevawtkdelkealddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtl
    iehahtkpllpsqlvryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmfle
    lfaqiisepafntlrtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflit
    meksiedmteeafqkhiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylk
    tltkediikfykemlavdaprrhkvsvhvlaremdsnpvvgefpaqndinlsqapalpqp
    eviqnmtefkrglplfplvkphinfmaakl
    

    Sequence, based on observed residues (ATOM records):
    >3n56A (A:)
    npaikrignhitkspedkreyrglelangikvllisdpttdkssaaldvhigslsdppni
    aglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtnyyfdvshehlegald
    rfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatgnpkhpfskfgtgnk
    ytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltnlvvklfsevenknv
    plpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksnpghylghlighegp
    gsllselkskgwvntlvggqkegargfmffiinvdlteegllhvediilhmfqyiqklra
    egpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleevltaeylleefrpdl
    iemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdevikkwqnadlngkfk
    lptknefiptnfeilplekeatpypalikdtamsklwfkqddkfflpkanlnfeffspfa
    yvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmylsvkgyndkqpillk
    kiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrllmtevawtkdelkea
    lddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtliehahtkpllpsql
    vryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmflelfaqiisepafntl
    rtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflitmeksiedmteeafq
    khiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylktltkediikfykem
    lavdaprrhkvsvhvlaremsqapalpqpeviqnmtefkrglplfplvkph
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n56B (B:)
    mhhhhhhaagipmnnpaikrignhitkspedkreyrglelangikvllisdpttdkssaa
    ldvhigslsdppniaglshflqhmlflgtkkypkeneysqflsehagssnaftsgehtny
    yfdvshehlegaldrfaqfflsplfdesakdrevnavdseheknvmndawrlfqlekatg
    npkhpfskfgtgnkytletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltn
    lvvklfsevenknvplpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksn
    pghylghlighegpgsllselkskgwvntlvggqkegargfmffiinvdlteegllhved
    iilhmfqyiqklraegpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleev
    ltaeylleefrpdliemvldklrpenvrvaivsksfegktdrteewygtqykqeaipdev
    ikkwqnadlngkfklptknefiptnfeilplekeatpypalikdtamsklwfkqddkffl
    pkanlnfeffspfayvdplhsnmaylylellkdslneyayaaelaglsydlqntiygmyl
    svkgyndkqpillkkiiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrll
    mtevawtkdelkealddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtl
    iehahtkpllpsqlvryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmfle
    lfaqiisepafntlrtkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflit
    meksiedmteeafqkhiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylk
    tltkediikfykemlavdaprrhkvsvhvlaremdsnpvvgefpaqndinlsqapalpqp
    eviqnmtefkrglplfplvkphinfmaakl
    

    Sequence, based on observed residues (ATOM records):
    >3n56B (B:)
    paikrignhitkspedkreyrglelangikvllisdpttdkssaaldvhigslsdppnia
    glshflqhmlflgtkkypkeneysqflsehagssnaftsgehtnyyfdvshehlegaldr
    faqfflsplfdesakdrevnavdseheknvmndawrlfqlekatgnpkhpfskfgtgnky
    tletrpnqegidvrqellkfhsayyssnlmavvvlgreslddltnlvvklfsevenknvp
    lpefpehpfqeehlkqlykivpikdirnlyvtfpipdlqkyyksnpghylghlighegpg
    sllselkskgwvntlvggqkegargfmffiinvdlteegllhvediilhmfqyiqklrae
    gpqewvfqelkdlnavafrfkdkerprgytskiagilhyypleevltaeylleefrpdli
    emvldklrpenvrvaivsksfegktdrteewygtqykqeaipdevikkwqnadlngkfkl
    ptknefiptnfeilplekeatpypalikdtamsklwfkqddkfflpkanlnfeffspfay
    vdplhsnmaylylellkdslneyayaaelaglsydlqntiygmylsvkgyndkqpillkk
    iiekmatfeidekrfeiikeaymrslnnfraeqphqhamyylrllmtevawtkdelkeal
    ddvtlprlkafipqllsrlhieallhgnitkqaalgimqmvedtliehahtkpllpsqlv
    ryrevqlpdrgwfvyqqrnevhnnsgieiyyqtdmqstsenmflelfaqiisepafntlr
    tkeqlgyivfsgprrangiqglrfiiqsekpphylesrveaflitmeksiedmteeafqk
    hiqalairrldkpkklsaesakywgeiisqqynfdrdntevaylktltkediikfykeml
    avdaprrhkvsvhvlaremlsqapalpqpeviqnmtefkrglplfplvkph
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n56C (C:)
    spkmvqgsgcfgrkmdrissssglgckvlrrh
    

    Sequence, based on observed residues (ATOM records):
    >3n56C (C:)
    sp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n56D (D:)
    spkmvqgsgcfgrkmdrissssglgckvlrrh
    

    Sequence, based on observed residues (ATOM records):
    >3n56D (D:)
    sp