PDB entry 3n55

View 3n55 on RCSB PDB site
Description: SO1698 protein, an aspartic peptidase from Shewanella oneidensis.
Class: hydrolase
Keywords: structural genomics, aspartic peptidase, autocatalysis, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2010-05-24, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n55.1
  • Chain 'B':
    Compound: Peptidase
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO_1698
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n55.1
  • Heterogens: BME, ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n55A (A:)
    snamfapqglaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkg
    lkfvgvgfvtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n55A (A:)
    glaqfikvnvtlengepvfiytdangqvcqgditvtqagtityllndqtlkglkfvgvgf
    vtpfdgiidavtissdgmlvqlvdldktpgttkfqfvlsntantllvlspd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n55B (B:)
    pqiinrpqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n55B (B:)
    pqiinrp