PDB entry 3n52

View 3n52 on RCSB PDB site
Description: crystal Structure analysis of MIP2
Class: cytokine
Keywords: MIP-2 Structure, macrophage inflammatory protein 2, cxcl2, CYTOKINE
Deposited on 2010-05-24, released 2011-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-X-C motif chemokine 2
    Species: Mus musculus [TaxId:10090]
    Gene: Cxcl2, Mip-2, Mip2, Scyb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3n52a_
  • Chain 'B':
    Compound: C-X-C motif chemokine 2
    Species: Mus musculus [TaxId:10090]
    Gene: Cxcl2, Mip-2, Mip2, Scyb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3n52b_
  • Chain 'C':
    Compound: C-X-C motif chemokine 2
    Species: Mus musculus [TaxId:10090]
    Gene: Cxcl2, Mip-2, Mip2, Scyb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3n52c_
  • Chain 'D':
    Compound: C-X-C motif chemokine 2
    Species: Mus musculus [TaxId:10090]
    Gene: Cxcl2, Mip-2, Mip2, Scyb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3n52d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n52A (A:)
    avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
    kiiqkilnkgkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n52A (A:)
    selrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvqkiiq
    kilnkgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n52B (B:)
    avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
    kiiqkilnkgkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n52B (B:)
    vvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvqk
    iiqkilnkgka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n52C (C:)
    avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
    kiiqkilnkgkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n52C (C:)
    selrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvqkiiq
    kilnkgk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n52D (D:)
    avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
    kiiqkilnkgkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n52D (D:)
    avvaselrcqclktlprvdfkniqslsvtppgphcaqteviatlkggqkvcldpeaplvq
    kiiqkilnkg