PDB entry 3n50

View 3n50 on RCSB PDB site
Description: human early b-cell factor 3 (ebf3) ipt/tig and hlhlh domains
Deposited on 2010-05-24, released 2010-06-16
The last revision was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.19
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor COE3
    Species: Homo sapiens [TaxId:9606]
    Gene: COE3, DKFZp667I0324, EBF3, HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4W6 (4-End)
      • expression tag (3)
  • Chain 'B':
    Compound: Transcription factor COE3
    Species: Homo sapiens [TaxId:9606]
    Gene: COE3, DKFZp667I0324, EBF3, HLA-DQB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transcription factor COE3
    Species: Homo sapiens [TaxId:9606]
    Gene: COE3, DKFZp667I0324, EBF3, HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4W6 (4-End)
      • expression tag (3)
  • Chain 'D':
    Compound: Transcription factor COE3
    Species: Homo sapiens [TaxId:9606]
    Gene: COE3, DKFZp667I0324, EBF3, HLA-DQB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcription factor COE3
    Species: Homo sapiens [TaxId:9606]
    Gene: COE3, DKFZp667I0324, EBF3, HLA-DQB1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Transcription factor COE3
    Species: Homo sapiens [TaxId:9606]
    Gene: COE3, DKFZp667I0324, EBF3, HLA-DQB1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n50A (A:)
    smseatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtp
    prhipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpk
    evllkraadlvealygmphnnqeiilkraadiaealysv
    

    Sequence, based on observed residues (ATOM records):
    >3n50A (A:)
    eatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtpprh
    ipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpkevl
    lkraadlvealygm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n50B (B:)
    smseatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtp
    prhipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpk
    evllkraadlvealygmphnnqeiilkraadiaealysv
    

    Sequence, based on observed residues (ATOM records):
    >3n50B (B:)
    atpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtpprhi
    pgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpkevll
    kraadlvealygmphnnqeiilkraadiaealys
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n50C (C:)
    smseatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtp
    prhipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpk
    evllkraadlvealygmphnnqeiilkraadiaealysv
    

    Sequence, based on observed residues (ATOM records):
    >3n50C (C:)
    eatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtpprh
    ipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpkevl
    lkraadlvealygmilkraadiaeal
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n50D (D:)
    smseatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtp
    prhipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpk
    evllkraadlvealygmphnnqeiilkraadiaealysv
    

    Sequence, based on observed residues (ATOM records):
    >3n50D (D:)
    atpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtpprhi
    pgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpkevll
    kraadlvealygmphnnqeiilkraadiaealys
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n50E (E:)
    smseatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtp
    prhipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpk
    evllkraadlvealygmphnnqeiilkraadiaealysv
    

    Sequence, based on observed residues (ATOM records):
    >3n50E (E:)
    atpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtpprhi
    pgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpkevll
    kraadlvealygmiilkraadiaeal
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n50F (F:)
    smseatpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtp
    prhipgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpk
    evllkraadlvealygmphnnqeiilkraadiaealysv
    

    Sequence, based on observed residues (ATOM records):
    >3n50F (F:)
    atpcikaispsegwttggatviiigdnffdglqvvfgtmlvwselitphairvqtpprhi
    pgvvevtlsykskqfckgapgrfvytalneptidygfqrlqkviprhpgdperlpkevll
    kraadlvealygmphnnqeiilkraadiaealys