PDB entry 3n4z

View 3n4z on RCSB PDB site
Description: Crystal structure of quintuple Arg-to-Lys variant of T. celer L30e
Deposited on 2010-05-24, released 2010-06-09
The last revision was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l30e
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29160 (0-End)
      • engineered mutation (8)
      • engineered mutation (21)
      • engineered mutation (42)
      • engineered mutation (54)
      • engineered mutation (76)
  • Chain 'B':
    Compound: 50s ribosomal protein l30e
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29160
      • engineered mutation (8)
      • engineered mutation (21)
      • engineered mutation (42)
      • engineered mutation (54)
      • engineered mutation (76)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4zA (A:)
    mvdfafelkkaqdtgkivmgakksiqyakmggakliivarnakpdikedieyyaklsgip
    vyefegtsvelgtllgkphtvsalavvdpgesrilalggke
    

    Sequence, based on observed residues (ATOM records):
    >3n4zA (A:)
    mvdfafelkkaqdtgkivmgakksiqyakmggakliivarnakpdikedieyyaklsgip
    vyefegtsvelgtllgkphtvsalavvdpgesrilalg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4zB (B:)
    mvdfafelkkaqdtgkivmgakksiqyakmggakliivarnakpdikedieyyaklsgip
    vyefegtsvelgtllgkphtvsalavvdpgesrilalggke
    

    Sequence, based on observed residues (ATOM records):
    >3n4zB (B:)
    vdfafelkkaqdtgkivmgakksiqyakmggakliivarnakpdikedieyyaklsgipv
    yefegtsvelgtllgkphtvsalavvdpgesrilalg