PDB entry 3n4y

View 3n4y on RCSB PDB site
Description: crystal structure of wild-type t. celer l30e in low ionic strength condition without precipitant
Deposited on 2010-05-24, released 2010-06-09
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l30e
    Species: THERMOCOCCUS CELER [TaxId:2264]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4yA (A:)
    mvdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgip
    vyefegtsvelgtllgrphtvsalavvdpgesrilalggke
    

    Sequence, based on observed residues (ATOM records):
    >3n4yA (A:)
    vdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgipv
    yefegtsvelgtllgrphtvsalavvdpgesrilalgg