PDB entry 3n4w

View 3n4w on RCSB PDB site
Description: crystal structure of an abridged ser to ala mutant of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase ica512/ia-2 at ph 7.5
Deposited on 2010-05-23, released 2010-12-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase-like N
    Species: Homo sapiens [TaxId:9606]
    Gene: ICA3, ICA512, PTPRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16849 (0-End)
      • engineered mutation (38)
  • Chain 'B':
    Compound: Receptor-type tyrosine-protein phosphatase-like N
    Species: Homo sapiens [TaxId:9606]
    Gene: ICA3, ICA512, PTPRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16849 (0-End)
      • engineered mutation (38)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4wA (A:)
    eygyivtdqkplslaagvklleilaehvhmssgsfiniavvgpaltfrirhneqnlslad
    vtqqaglvkseleaqtglqilqtgvgqre
    

    Sequence, based on observed residues (ATOM records):
    >3n4wA (A:)
    eygyivtdqkplslaagvklleilaehvhmssgsfiniavvgpaltfrirhneqnlslad
    vtqqaglvkseleaqtglqilqtgvgq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4wB (B:)
    eygyivtdqkplslaagvklleilaehvhmssgsfiniavvgpaltfrirhneqnlslad
    vtqqaglvkseleaqtglqilqtgvgqre
    

    Sequence, based on observed residues (ATOM records):
    >3n4wB (B:)
    eygyivtdqkplslaagvklleilaehvhmssgsfiniavvgpaltfrirsladvtqqag
    lvkseleaqtglqilqtgvgq