PDB entry 3n4v

View 3n4v on RCSB PDB site
Description: apo APH(2")-IVa form III
Deposited on 2010-05-22, released 2010-06-30
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: APH(2'')-Id
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: aph(2'')-Id
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68183 (0-End)
      • conflict (171)
      • conflict (297)
  • Chain 'B':
    Compound: APH(2'')-Id
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: aph(2'')-Id
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68183 (0-End)
      • conflict (171)
      • conflict (297)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4vA (A:)
    mrtytfdqvekaieqlypdftintieisgegndciayeinrdfifkfpkhsrgstnlfne
    vnilkrihnklplpipevvftgmpsetyqmsfagftkikgvpltplllnnlpkqsqnqaa
    kdlarflselhsinisgfksnlvldfrekinednkkikkllsrelkgpqmkavddfyrdi
    leneiyfkyypclihndfssdhilfdteknticgiidfgdaaisdpdndfislmeddeey
    gmefvskilnhykhkdiptvlekyrmkekywsfekiiygkeygymdwyeeglneirsaki
    k
    

    Sequence, based on observed residues (ATOM records):
    >3n4vA (A:)
    mrtytfdqvekaieqlypdftintieisgegndciayeinrdfifkfpkhsrgstnlfne
    vnilkrihnklplpipevvftgmpsetyqmsfagftkikgvpltplllnnlpkqsqnqaa
    kdlarflselhsinisgfksnlvldfrekinednkkikkllsrelkgpqmkavddfyrdi
    leneiyfkyypclihndfssdhilfdteknticgiidfgdaaisdpdndfislmeddeey
    gmefvskilnhykhkdiptvlekyrmkekywsfekiiygkeygymdwyeeglneirsa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4vB (B:)
    mrtytfdqvekaieqlypdftintieisgegndciayeinrdfifkfpkhsrgstnlfne
    vnilkrihnklplpipevvftgmpsetyqmsfagftkikgvpltplllnnlpkqsqnqaa
    kdlarflselhsinisgfksnlvldfrekinednkkikkllsrelkgpqmkavddfyrdi
    leneiyfkyypclihndfssdhilfdteknticgiidfgdaaisdpdndfislmeddeey
    gmefvskilnhykhkdiptvlekyrmkekywsfekiiygkeygymdwyeeglneirsaki
    k
    

    Sequence, based on observed residues (ATOM records):
    >3n4vB (B:)
    mrtytfdqvekaieqlypdftintieisgegndciayeinrdfifkfpkhsrgstnlfne
    vnilkrihnklplpipevvftgmpsetyqmsfagftkikgvpltplllnnlpkqsqnqaa
    kdlarflselhsinisgfksnlvldfrekinednkkikkllsrelkgpqmkavddfyrdi
    leneiyfkyypclihndfssdhilfdteknticgiidfgdaaisdpdndfislmeddeey
    gmefvskilnhykhkdiptvlekyrmkekywsfekiiygkeygymdwyeeglneirsa