PDB entry 3n4u

View 3n4u on RCSB PDB site
Description: app APH(2")-IVa form II
Deposited on 2010-05-22, released 2010-06-30
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: APH(2'')-Id
    Species: Enterococcus casseliflavus [TaxId:37734]
    Gene: aph(2'')-Id
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n4uA (A:)
    mrtytfdqvekaieqlypdftintieisgegndciayeinrdfifkfpkhsrgstnlfne
    vnilkrihnklplpipevvftgmpsetyqmsfagftkikgvpltplllnnlpkqsqnqaa
    kdlarflselhsinisgfksnlvldfrekinednkkikkllsrelkgpqmkkvddfyrdi
    leneiyfkyypclihndfssdhilfdteknticgiidfgdaaisdpdndfislmeddeey
    gmefvskilnhykhkdiptvlekyrmkekywsfekiiygkeygymdwyeeglneirsiki
    k