PDB entry 3n4s

View 3n4s on RCSB PDB site
Description: Structure of Csm1 C-terminal domain, P21212 form
Deposited on 2010-05-22, released 2010-09-01
The last revision was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1PE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4sA (A:)
    snaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdyklgfvkg
    qaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiakslnk
    

    Sequence, based on observed residues (ATOM records):
    >3n4sA (A:)
    nsevikdlyeylcnvrvhksyedsglwfdisqgtdysimdyklgfvteviyapvlkqrst
    eelyslqsklpeylfetlsfplsslnqfynkiakslnk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4sB (B:)
    snaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdyklgfvkg
    qaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiakslnk
    

    Sequence, based on observed residues (ATOM records):
    >3n4sB (B:)
    nsevikdlyeylcnvrvhksyeddsglwfdisqgtsimdyklgfvkgqaqvteviyapvl
    kqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n4sC (C:)
    snaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdyklgfvkg
    qaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiakslnk
    

    Sequence, based on observed residues (ATOM records):
    >3n4sC (C:)
    nsevikdlyeylcnvrvhksyeddsglwfdisqgtysimdyklgfvvteviyapvlkqrs
    teelyslqsklpeylfetlsfplsslnqfynkiaksln
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n4sD (D:)
    snaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdyklgfvkg
    qaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiakslnk
    

    Sequence, based on observed residues (ATOM records):
    >3n4sD (D:)
    sevikdlyeylcnvrvhksyeddsglwfdisqgtdysimdyklgfvkqvteviyapvlkq
    rsteelyslqsklpeylfetlsfplsslnqfynkiaksln